StarFunc result for job id O00203

User Input

>input (1094 residues)
MSSNSFPYNEQSGGGEATELGQEATSTISPSGAFGLFSSDLKKNEDLKQMLESNKDSAKL
DAMKRIVGMIAKGKNASELFPAVVKNVASKNIEIKKLVYVYLVRYAEEQQDLALLSISTF
QRALKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEASADLSPYVRKNAAHAIQKLYSL
DPEQKEMLIEVIEKLLKDKSTLVAGSVVMAFEEVCPDRIDLIHKNYRKLCNLLVDVEEWG
QVVIIHMLTRYARTQFVSPWKEGDELEDNGKNFYESDDDQKEKTDKKKKPYTMDPDHRLL
IRNTKPLLQSRNAAVVMAVAQLYWHISPKSEAGIISKSLVRLLRSNREVQYIVLQNIATM
SIQRKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVKSQDKQF
AAATIQTIGRCATNILEVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEII
KHMAKLLDSITVPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLG
AKLYLTNSKQTKLLTQYILNLGKYDQNYDIRDRTRFIRQLIVPNVKSGALSKYAKKIFLA
QKPAPLLESPFKDRDHFQLGTLSHTLNIKATGYLELSNWPEVAPDPSVRNVEVIELAKEW
TPAGKAKQENSAKKFYSESEEEEDSSDSSSDSESESGSESGEQGESGEEGDSNEDSSEDS
SSEQDSESGRESGLENKRTAKRNSKAKGKSDSEDGEKENEKSKTSDSSNDESSSIEDSSS
DSESESEPESESESRRVTKEKEKKTKQDRTPLTKDVSLLDLDDFNPVSTPVALPTPALSP
SLMADLEGLHLSTSSSVISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMV
SIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGSITVSMGIDFCDSTQTA
SFQLCTKDDCFNVNIQPPVGELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPS
VIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIG
SVLLRELKPVLSQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K586	0.619	0.619	0.000	1094	0.997	0.997	A8K586.pdb.gz	A8K586_HUMAN AP-3 complex subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q9Z1T1	0.725	0.718	0.000	1105	0.885	0.876	Q9Z1T1.pdb.gz	AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap3b1 PE=1 SV=2
3	AFDB:O45718	0.514	0.590	3.120E-58	945	0.360	0.417	O45718.pdb.gz	O45718_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
4	AFDB:Q383L4	0.507	0.601	3.596E-35	918	0.230	0.275	Q383L4.pdb.gz	Q383L4_TRYB2 AP-3 complex subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2420 PE=3 SV=1
5	AFDB:O13939	0.488	0.702	5.143E-32	745	0.205	0.301	O13939.pdb.gz	AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl6 PE=1 SV=1
6	AFDB:F4JXV9	0.451	0.570	2.927E-24	850	0.177	0.228	F4JXV9.pdb.gz	F4JXV9_ARATH Beta-adaptin-like protein OS=Arabidopsis thaliana OX=3702 GN=AP4B PE=1 SV=1
7	PDB:7p3xB	0.359	0.574	8.819E-19	621	0.152	0.267	7p3xB.pdb.gz
8	PDB:6yafB	0.423	0.750	1.709E-17	579	0.158	0.299	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
9	PDB:5a1uE	0.337	0.424	3.148E-14	824	0.107	0.142	5a1uE.pdb.gz
10	PDB:5a1uG	0.202	0.251	9.048E-10	813	0.118	0.159	5a1uG.pdb.gz
11	PDB:5nzrG	0.331	0.428	7.102E-9	798	0.110	0.150	5nzrG.pdb.gz
12	PDB:7p3xA	0.362	0.628	2.258E-8	576	0.072	0.137	7p3xA.pdb.gz
13	PDB:1b3uA	0.233	0.382	6.679E-8	588	0.077	0.143	1b3uA.pdb.gz
14	PDB:4jlqA	0.214	0.257	5.843E-7	840	0.079	0.102	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	AFDB:Q9XZ34	0.161	0.129	6.513E-7	1416	0.103	0.080	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
16	AFDB:Q6A070	0.129	0.088	1.667E-6	1776	0.113	0.070	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
17	PDB:7rroH7	0.224	0.349	2.147E-6	580	0.081	0.153	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	AFDB:F4I6B2	0.127	0.151	3.082E-6	811	0.104	0.141	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
19	PDB:3w3uA	0.200	0.209	3.828E-6	1030	0.067	0.071	3w3uA.pdb.gz
20	AFDB:Q961B0	0.130	0.133	4.587E-6	1067	0.109	0.112	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K586	0.0	2241	1094	0.997	0.997	A8K586_HUMAN AP-3 complex subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	O00203	0.0	2248	1094	1.000	1.000	AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1 PE=1 SV=3
3	O45718	0.0	626	945	0.287	0.332	O45718_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
4	O62348	0.0	631	935	0.286	0.335	O62348_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
5	O77290	0.0	978	1160	0.510	0.481	O77290_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=2 SV=1
6	Q13367	0.0	1274	1082	0.612	0.618	AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens OX=9606 GN=AP3B2 PE=1 SV=2
7	Q3MNE1	0.0	1631	800	0.729	0.998	Q3MNE1_HUMAN Adaptor-related protein complex 3 beta 1 subunit (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q556J8	0.0	583	1108	0.293	0.289	AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum OX=44689 GN=ap3b-1 PE=3 SV=1
9	Q7YU20	0.0	856	1159	0.388	0.367	Q7YU20_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=2 SV=1
10	Q9JME5	0.0	1051	1082	0.471	0.476	AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus OX=10090 GN=Ap3b2 PE=1 SV=2
11	Q9W4K1	0.0	978	1160	0.510	0.481	Q9W4K1_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=1 SV=1
12	Q9Z1T1	0.0	1835	1105	0.867	0.859	AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap3b1 PE=1 SV=2
13	F4IWW1	4.21e-114	382	1115	0.235	0.230	F4IWW1_ARATH AP-3 complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=PAT2 PE=1 SV=1
14	Q383L4	1.61e-110	368	918	0.218	0.259	Q383L4_TRYB2 AP-3 complex subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2420 PE=3 SV=1
15	O13939	3.65e-98	330	745	0.210	0.309	AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl6 PE=1 SV=1
16	Q54X82	1.36e-72	262	942	0.159	0.185	AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum OX=44689 GN=ap1b1 PE=3 SV=1
17	Q9DBG3	2.22e-72	261	937	0.165	0.193	AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus OX=10090 GN=Ap2b1 PE=1 SV=1
18	P62944	2.79e-72	261	937	0.165	0.193	AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1
19	P63010	2.79e-72	261	937	0.165	0.193	AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1
20	Q3ZB97	3.08e-72	261	951	0.165	0.190	Q3ZB97_RAT AP complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	5.6e-164	558.2	Adaptin N terminal region
2	PF14796 AP3B1_C	1.8e-55	198.7	Clathrin-adaptor complex-3 beta-1 subunit C-terminal
3	PF12717 Cnd1	1.1e-17	76.0	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	0.044	25.1	HEAT repeat
5	PF13646 HEAT_2	0.00047	31.8	HEAT repeats
6	PF13513 HEAT_EZ	1.5	20.7	HEAT-like repeat
7	PF14797 SEEEED	4.2e-27	106.1	Serine-rich region of AP3B1, clathrin-adaptor complex

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325369	0.999	AP-3 complex subunit sigma-1
2	9606.ENSP00000347408	0.999	AP-3 complex subunit mu-1
3	9606.ENSP00000347416	0.999	AP-3 complex subunit delta-1
4	9606.ENSP00000440005	0.993	ADP-ribosylation factor 1
5	9606.ENSP00000428787	0.989	AP-3 complex subunit mu-2
6	9606.ENSP00000338777	0.976	AP-3 complex subunit sigma-2
7	9606.ENSP00000261842	0.969	AP-4 complex subunit epsilon-1
8	9606.ENSP00000386443	0.948	Trans-Golgi network integral membrane protein 2
9	9606.ENSP00000357674	0.947	SNARE-associated protein Snapin
10	9606.ENSP00000314499	0.938	Cyclin-G-associated kinase
11	9606.ENSP00000358582	0.927	AP-4 complex subunit beta-1
12	9606.ENSP00000360108	0.925	Putative tyrosine-protein phosphatase auxilin
13	9606.ENSP00000353224	0.923	Transferrin receptor protein 1
14	9606.ENSP00000256637	0.920	Sortilin
15	9606.ENSP00000368831	0.920	Sorting nexin-2
16	9606.ENSP00000377015	0.913	Phosphatidylinositol-binding clathrin assembly protein
17	9606.ENSP00000349437	0.911	Cation-independent mannose-6-phosphate receptor
18	9606.ENSP00000360154	0.911	Inositol polyphosphate 5-phosphatase OCRL-1
19	9606.ENSP00000253083	0.907	Huntingtin-interacting protein 1-related protein
20	9606.ENSP00000225719	0.906	M14 carboxypeptidases

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019899	0.990	enzyme binding
GO:0030742	0.825	GTP-dependent protein binding
GO:0019902	0.803	phosphatase binding
GO:0140312	0.717	cargo adaptor activity
GO:0035615	0.714	clathrin adaptor activity
GO:0019903	0.636	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006810	0.989	transport
GO:0051641	0.984	cellular localization
GO:0043473	0.965	pigmentation
GO:0051649	0.958	establishment of localization in cell
GO:0046907	0.927	intracellular transport
GO:0015031	0.897	protein transport
GO:0016043	0.869	cellular component organization
GO:0016050	0.851	vesicle organization
GO:0033059	0.841	cellular pigmentation
GO:0048753	0.807	pigment granule organization
GO:0016192	0.788	vesicle-mediated transport
GO:0032438	0.755	melanosome organization
GO:0006886	0.675	intracellular protein transport
GO:0065007	0.615	biological regulation
GO:0050789	0.535	regulation of biological process
GO:0050794	0.488	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0031090	0.981	organelle membrane
GO:0098588	0.940	bounding membrane of organelle
GO:0005764	0.938	lysosome
GO:0005774	0.890	vacuolar membrane
GO:0031982	0.885	vesicle
GO:0005829	0.874	cytosol
GO:0098852	0.864	lytic vacuole membrane
GO:0005765	0.845	lysosomal membrane
GO:0097708	0.806	intracellular vesicle
GO:0005794	0.803	Golgi apparatus
GO:0031410	0.741	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]