StarFunc result for job id O00206

User Input

>input (839 residues)
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00206	1.000	1.000	0.000	839	1.000	1.000	O00206.pdb.gz	TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens OX=9606 GN=TLR4 PE=1 SV=2
2	AFDB:Q9QUK6	0.754	0.758	2.655E-94	835	0.652	0.655	Q9QUK6.pdb.gz	TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus OX=10090 GN=Tlr4 PE=1 SV=1
3	AFDB:Q9QX05	0.733	0.736	4.972E-94	835	0.657	0.660	Q9QX05.pdb.gz	TLR4_RAT Toll-like receptor 4 OS=Rattus norvegicus OX=10116 GN=Tlr4 PE=2 SV=1
4	AFDB:Q7ZTG5	0.688	0.685	2.280E-72	843	0.446	0.444	Q7ZTG5.pdb.gz	Q7ZTG5_CHICK TLR4 OS=Gallus gallus OX=9031 GN=TLR4 PE=3 SV=1
5	AFDB:B8A691	0.625	0.639	2.889E-57	819	0.367	0.376	B8A691.pdb.gz	B8A691_DANRE Toll-like receptor 4b, duplicate b OS=Danio rerio OX=7955 GN=tlr4b PE=3 SV=1
6	AFDB:B8A689	0.632	0.672	5.410E-57	787	0.353	0.376	B8A689.pdb.gz
7	AFDB:Q62192	0.584	0.725	1.490E-34	661	0.219	0.278	Q62192.pdb.gz	CD180_MOUSE CD180 antigen OS=Mus musculus OX=10090 GN=Cd180 PE=1 SV=2
8	AFDB:Q6R5N8	0.438	0.382	2.668E-34	991	0.259	0.219	Q6R5N8.pdb.gz	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
9	AFDB:Q0PQ88	0.546	0.517	1.170E-33	896	0.251	0.235	Q0PQ88.pdb.gz	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
10	AFDB:Q99467	0.571	0.708	4.293E-33	661	0.225	0.286	Q99467.pdb.gz	CD180_HUMAN CD180 antigen OS=Homo sapiens OX=9606 GN=CD180 PE=1 SV=2
11	PDB:3t6qA	0.616	0.839	2.833E-30	601	0.212	0.296	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
12	PDB:3j0aA	0.579	0.607	2.226E-29	797	0.217	0.228	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
13	PDB:3b2dA	0.596	0.808	2.503E-28	601	0.217	0.303	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:7wv3A	0.526	0.637	7.120E-21	668	0.186	0.234	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
15	PDB:7tvfD	0.290	0.411	9.394E-11	515	0.129	0.210	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
16	PDB:6gffI	0.364	0.512	5.899E-10	551	0.168	0.256	6gffI.pdb.gz
17	PDB:7wrqA	0.307	0.423	1.397E-7	566	0.150	0.223	7wrqA.pdb.gz
18	PDB:7p5vB	0.255	0.284	1.148E-6	732	0.097	0.111	7p5vB.pdb.gz
19	PDB:1xcdA	0.209	0.479	2.150E-6	305	0.085	0.233	1xcdA.pdb.gz
20	PDB:5xjxC	0.141	0.287	1.180E-5	365	0.105	0.241	5xjxC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00206	0.0	1718	839	1.000	1.000	TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens OX=9606 GN=TLR4 PE=1 SV=2
2	Q7ZTG5	0.0	712	843	0.449	0.447	Q7ZTG5_CHICK TLR4 OS=Gallus gallus OX=9031 GN=TLR4 PE=3 SV=1
3	Q9QUK6	0.0	1087	835	0.664	0.667	TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus OX=10090 GN=Tlr4 PE=1 SV=1
4	Q9QX05	0.0	1094	835	0.666	0.669	TLR4_RAT Toll-like receptor 4 OS=Rattus norvegicus OX=10116 GN=Tlr4 PE=2 SV=1
5	B8A691	1.70e-159	487	819	0.379	0.388	B8A691_DANRE Toll-like receptor 4b, duplicate b OS=Danio rerio OX=7955 GN=tlr4b PE=3 SV=1
6	Q6TS41	5.12e-159	486	819	0.378	0.387	Q6TS41_DANRE Toll-like receptor 4b OS=Danio rerio OX=7955 GN=tlr4bb PE=2 SV=1
7	B3U3W0	1.12e-150	462	750	0.347	0.388	B3U3W0_DANRE Toll-like receptor 4a OS=Danio rerio OX=7955 GN=TIR4.1 PE=2 SV=1
8	Q62192	4.99e-59	215	661	0.226	0.287	CD180_MOUSE CD180 antigen OS=Mus musculus OX=10090 GN=Cd180 PE=1 SV=2
9	Q99467	8.76e-55	203	661	0.223	0.283	CD180_HUMAN CD180 antigen OS=Homo sapiens OX=9606 GN=CD180 PE=1 SV=2
10	Q0V8G5	1.29e-53	199	661	0.212	0.269	Q0V8G5_BOVIN CD180 antigen OS=Bos taurus OX=9913 GN=CD180 PE=1 SV=1
11	Q9QUN7	2.10e-49	189	784	0.269	0.288	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
12	F8W4F1	4.82e-49	189	881	0.263	0.251	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2
13	Q6R5N8	1.62e-48	188	991	0.288	0.244	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
14	F8W3J5	2.39e-47	184	881	0.263	0.251	F8W3J5_DANRE Toll-like receptor 5b OS=Danio rerio OX=7955 GN=tlr5 PE=1 SV=1
15	A0A2R8RTN4	2.68e-47	184	955	0.291	0.255	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
16	Q9DD78	1.79e-46	181	793	0.238	0.252	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
17	B3DIN1	2.63e-46	181	875	0.249	0.239	B3DIN1_DANRE Tlr5b protein OS=Danio rerio OX=7955 GN=tlr5b PE=1 SV=1
18	E9PTD9	2.16e-44	174	784	0.278	0.297	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
19	Q6YGU2	6.40e-44	172	784	0.278	0.297	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
20	Q0PQ88	2.46e-43	172	896	0.267	0.250	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08937 DUF1863	1.7	20.3	MTH538 TIR-like domain (DUF1863)
2	PF00560 LRR_1	0.0044	28.1	Leucine Rich Repeat
3	PF12799 LRR_4	2e-24	96.4	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.047	24.8	Leucine Rich repeat
5	PF13855 LRR_8	7.7e-45	161.8	Leucine rich repeat
6	PF14580 LRR_9	3.1e-05	35.1	Leucine-rich repeat
7	PF01582 TIR	8.7e-33	125.1	TIR domain
8	PF13676 TIR_2	1.5e-08	46.7	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000248244	0.999	TIR domain-containing adapter molecule 1
2	9606.ENSP00000284818	0.999	Lymphocyte antigen 96
3	9606.ENSP00000304236	0.999	Monocyte differentiation antigen CD14
4	9606.ENSP00000345347	0.999	High mobility group protein B1
5	9606.ENSP00000358997	0.999	Interleukin-1 receptor-associated kinase 1
6	9606.ENSP00000373620	0.999	60 kDa heat shock protein, mitochondrial
7	9606.ENSP00000376445	0.999	Toll/interleukin-1 receptor domain-containing adapter protein
8	9606.ENSP00000415139	0.999	TIR domain-containing adapter molecule 2
9	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
10	9606.ENSP00000369286	0.997	Lymphocyte antigen 86
11	9606.ENSP00000327336	0.995	Biglycan
12	9606.ENSP00000401399	0.995	Myeloid differentiation primary response protein MyD88
13	9606.ENSP00000263317	0.994	NADPH oxidase 4
14	9606.ENSP00000364907	0.994	Tyrosine-protein kinase SYK
15	9606.ENSP00000454207	0.994	TNF receptor-associated factor 3
16	9606.ENSP00000302961	0.992	Heat shock protein family A member 4
17	9606.ENSP00000390651	0.992	Interleukin-1 receptor-associated kinase 4
18	9606.ENSP00000339191	0.990	Caveolin-1
19	9606.ENSP00000221515	0.989	Resistin
20	9606.ENSP00000346839	0.989	Fibronectin type III domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038187	1.000	pattern recognition receptor activity
GO:0008289	0.972	lipid binding
GO:0042277	0.924	peptide binding
GO:0005102	0.877	signaling receptor binding
GO:0042802	0.755	identical protein binding
GO:0097367	0.649	carbohydrate derivative binding
GO:0001530	0.632	lipopolysaccharide binding
GO:0001540	0.505	amyloid-beta binding
GO:0046983	0.426	protein dimerization activity
GO:0046982	0.314	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0048522	0.994	positive regulation of cellular process
GO:0007165	0.993	signal transduction
GO:0002376	0.988	immune system process
GO:0032101	0.986	regulation of response to external stimulus
GO:0010468	0.986	regulation of gene expression
GO:0031349	0.986	positive regulation of defense response
GO:0002682	0.984	regulation of immune system process
GO:0042221	0.982	response to chemical
GO:0002831	0.982	regulation of response to biotic stimulus
GO:0032677	0.980	regulation of interleukin-8 production
GO:0006950	0.979	response to stress
GO:0009893	0.977	positive regulation of metabolic process
GO:0032103	0.977	positive regulation of response to external stimulus
GO:0080090	0.975	regulation of primary metabolic process
GO:0023051	0.973	regulation of signaling
GO:0010646	0.973	regulation of cell communication
GO:1903555	0.972	regulation of tumor necrosis factor superfamily cytokine production
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0032732	0.969	positive regulation of interleukin-1 production
GO:0031323	0.966	regulation of cellular metabolic process
GO:0032722	0.966	positive regulation of chemokine production
GO:0044093	0.965	positive regulation of molecular function
GO:0010033	0.965	response to organic substance
GO:0032755	0.964	positive regulation of interleukin-6 production
GO:0010647	0.959	positive regulation of cell communication
GO:0006954	0.958	inflammatory response
GO:0023056	0.958	positive regulation of signaling
GO:0045089	0.958	positive regulation of innate immune response
GO:0051090	0.958	regulation of DNA-binding transcription factor activity
GO:0071310	0.955	cellular response to organic substance
GO:0032680	0.950	regulation of tumor necrosis factor production
GO:0051092	0.947	positive regulation of NF-kappaB transcription factor activity
GO:0033993	0.945	response to lipid
GO:1903557	0.944	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0050729	0.943	positive regulation of inflammatory response
GO:0071222	0.942	cellular response to lipopolysaccharide
GO:0032757	0.940	positive regulation of interleukin-8 production
GO:0032731	0.939	positive regulation of interleukin-1 beta production
GO:0002224	0.937	toll-like receptor signaling pathway
GO:0006955	0.936	immune response
GO:0002274	0.936	myeloid leukocyte activation
GO:1902533	0.900	positive regulation of intracellular signal transduction
GO:0042116	0.882	macrophage activation
GO:0071704	0.873	organic substance metabolic process
GO:1901698	0.870	response to nitrogen compound
GO:0098542	0.853	defense response to other organism
GO:0044238	0.852	primary metabolic process
GO:0044237	0.847	cellular metabolic process
GO:0043170	0.826	macromolecule metabolic process
GO:0048519	0.815	negative regulation of biological process
GO:0010941	0.803	regulation of cell death
GO:0006807	0.780	nitrogen compound metabolic process
GO:0043408	0.765	regulation of MAPK cascade
GO:0051173	0.720	positive regulation of nitrogen compound metabolic process
GO:0009628	0.712	response to abiotic stimulus
GO:0007166	0.708	cell surface receptor signaling pathway
GO:1901564	0.693	organonitrogen compound metabolic process
GO:0045087	0.691	innate immune response
GO:0031325	0.685	positive regulation of cellular metabolic process
GO:0009892	0.674	negative regulation of metabolic process
GO:0050790	0.660	regulation of catalytic activity
GO:0051246	0.655	regulation of protein metabolic process
GO:0010605	0.651	negative regulation of macromolecule metabolic process
GO:0033554	0.645	cellular response to stress
GO:0032879	0.628	regulation of localization
GO:0009719	0.603	response to endogenous stimulus
GO:0051179	0.590	localization
GO:0006796	0.584	phosphate-containing compound metabolic process
GO:0010243	0.546	response to organonitrogen compound
GO:0006810	0.545	transport
GO:0009595	0.516	detection of biotic stimulus
GO:0098581	0.507	detection of external biotic stimulus
GO:0032490	0.488	detection of molecule of bacterial origin
GO:0048523	0.474	negative regulation of cellular process
GO:0042742	0.472	defense response to bacterium
GO:0051247	0.452	positive regulation of protein metabolic process
GO:0019538	0.436	protein metabolic process
GO:0019220	0.420	regulation of phosphate metabolic process
GO:0032502	0.325	developmental process
GO:0048856	0.323	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.963	protein-containing complex
GO:0005622	0.944	intracellular anatomical structure
GO:0005737	0.918	cytoplasm
GO:0043227	0.835	membrane-bounded organelle
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0009986	0.575	cell surface
GO:0012505	0.557	endomembrane system
GO:0043235	0.341	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]