StarFunc result for job id O00213

User Input

>input (710 residues)
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL
ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLP
EPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELV
QKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46933	0.521	0.521	1.977E-102	711	0.939	0.938	P46933.pdb.gz	APBB1_RAT Amyloid beta precursor protein binding family B member 1 OS=Rattus norvegicus OX=10116 GN=Apbb1 PE=1 SV=3
2	AFDB:Q8IZW8	0.159	0.158	5.610E-8	715	0.141	0.140	Q8IZW8.pdb.gz	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
3	AFDB:Q9W2S5	0.177	0.068	4.517E-7	2139	0.131	0.043	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
4	PDB:7c3mA	0.121	0.146	3.229E-6	577	0.059	0.073	7c3mA.pdb.gz
5	AFDB:Q9VGI1	0.134	0.075	1.286E-5	1354	0.159	0.083	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
6	PDB:6xtbE	0.115	0.279	2.747E-5	235	0.041	0.123	6xtbE.pdb.gz
7	PDB:6upkH	0.108	0.167	6.984E-5	411	0.044	0.075	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
8	PDB:3ljuX	0.103	0.183	4.515E-4	373	0.039	0.075	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	AFDB:Q9H2D6	0.121	0.042	5.996E-4	2365	0.141	0.042	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
10	PDB:5yqrA	0.111	0.281	7.817E-4	268	0.010	0.026	5yqrA.pdb.gz
11	PDB:7nkyQ	0.097	0.160	9.216E-4	404	0.037	0.064	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
12	AFDB:P34288	0.104	0.054	1.293E-3	1605	0.135	0.060	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
13	PDB:4mk0A	0.124	0.138	1.686E-3	631	0.027	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:4gouA	0.110	0.150	2.100E-3	507	0.023	0.032	4gouA.pdb.gz
15	PDB:7r04A	0.114	0.039	2.615E-3	2326	0.021	0.006	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
16	PDB:6r9tA	0.106	0.036	4.057E-3	2185	0.018	0.006	6r9tA.pdb.gz
17	AFDB:Q13009	0.125	0.059	6.014E-3	1591	0.107	0.048	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
18	AFDB:Q6ZPF3	0.152	0.075	6.353E-3	1715	0.149	0.062	Q6ZPF3.pdb.gz	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
19	AFDB:Q99KW3	0.127	0.052	1.297E-2	2014	0.149	0.053	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
20	AFDB:M9PHU7	0.086	0.053	3.297E-2	1248	0.110	0.062	M9PHU7.pdb.gz	M9PHU7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG5741 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00213	0.0	1455	710	1.000	1.000	APBB1_HUMAN Amyloid beta precursor protein binding family B member 1 OS=Homo sapiens OX=9606 GN=APBB1 PE=1 SV=2
2	P46933	0.0	1338	711	0.937	0.935	APBB1_RAT Amyloid beta precursor protein binding family B member 1 OS=Rattus norvegicus OX=10116 GN=Apbb1 PE=1 SV=3
3	Q92870	0.0	592	758	0.489	0.458	APBB2_HUMAN Amyloid beta precursor protein binding family B member 2 OS=Homo sapiens OX=9606 GN=APBB2 PE=1 SV=3
4	Q9DBR4	0.0	597	760	0.496	0.463	APBB2_MOUSE Amyloid beta precursor protein binding family B member 2 OS=Mus musculus OX=10090 GN=Apbb2 PE=1 SV=2
5	Q9QXJ1	0.0	1333	710	0.944	0.944	APBB1_MOUSE Amyloid beta precursor protein binding family B member 1 OS=Mus musculus OX=10090 GN=Apbb1 PE=1 SV=3
6	V9GY97	0.0	542	261	0.368	1.000	V9GY97_HUMAN Amyloid beta precursor protein binding family B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=APBB1 PE=1 SV=8
7	O95704	6.21e-109	341	486	0.252	0.368	APBB3_HUMAN Amyloid-beta A4 precursor protein-binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=2
8	Q8R1C9	1.75e-108	340	486	0.255	0.372	APBB3_MOUSE Amyloid-beta A4 precursor protein-binding family B member 3 OS=Mus musculus OX=10090 GN=Apbb3 PE=2 SV=1
9	O35827	2.01e-106	335	504	0.251	0.353	APBB3_RAT Amyloid-beta A4 precursor protein-binding family B member 3 OS=Rattus norvegicus OX=10116 GN=Apbb3 PE=1 SV=1
10	Q9BKZ9	5.21e-78	265	665	0.213	0.227	FEH1_CAEEL Protein Fe65 homolog OS=Caenorhabditis elegans OX=6239 GN=feh-1 PE=1 SV=2
11	E7EX91	1.92e-72	240	339	0.180	0.378	E7EX91_HUMAN Amyloid beta precursor protein binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=1
12	D6RBA1	1.70e-69	232	337	0.179	0.377	D6RBA1_HUMAN Amyloid beta precursor protein binding family B member 3 OS=Homo sapiens OX=9606 GN=APBB3 PE=1 SV=2
13	Q8STF6	0.002	43.9	887	0.038	0.030	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
14	P16554	0.005	42.4	556	0.044	0.056	NUMB_DROME Protein numb OS=Drosophila melanogaster OX=7227 GN=numb PE=1 SV=2
15	Q9UBP9	0.009	41.2	304	0.041	0.095	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
16	F1LIN5	0.016	40.8	535	0.052	0.069	F1LIN5_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
17	Q9XTY6	0.017	40.8	593	0.052	0.062	NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
18	B5BM46	0.026	40.4	682	0.052	0.054	B5BM46_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
19	H0VD63	0.027	40.0	448	0.030	0.047	H0VD63_CAVPO Nitric oxide synthase 1 adaptor protein OS=Cavia porcellus OX=10141 GN=NOS1AP PE=4 SV=2
20	Q1XD15	0.031	40.0	680	0.044	0.046	Q1XD15_DANRE Numb OS=Danio rerio OX=7955 GN=numb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	2.6e-43	158.9	Phosphotyrosine interaction domain (PTB/PID)
2	PF08416 PTB	0.49	21.9	Phosphotyrosine-binding domain
3	PF00397 WW	0.0062	27.9	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.999	Amyloid-beta A4 protein
2	9606.ENSP00000340330	0.999	Histone acetyltransferase KAT5
3	9606.ENSP00000263574	0.989	Amyloid-like protein 2
4	9606.ENSP00000243077	0.973	Prolow-density lipoprotein receptor-related protein 1
5	9606.ENSP00000221891	0.955	Amyloid-like protein 1
6	9606.ENSP00000257915	0.945	Alpha-globin transcription factor CP2
7	9606.ENSP00000303634	0.944	Low-density lipoprotein receptor-related protein 8
8	9606.ENSP00000405330	0.944	Estrogen receptor
9	9606.ENSP00000378974	0.929	Mitogen-activated protein kinase 8
10	9606.ENSP00000349428	0.919	Polypyrimidine tract-binding protein 1
11	9606.ENSP00000355809	0.895	Protein enabled homolog
12	9606.ENSP00000453293	0.895	Amyloid-beta A4 precursor protein-binding family A member 2
13	9606.ENSP00000225688	0.837	Dexamethasone-induced Ras-related protein 1
14	9606.ENSP00000250237	0.831	Queuine tRNA-ribosyltransferase catalytic subunit 1
15	9606.ENSP00000361423	0.823	Tyrosine-protein kinase ABL1
16	9606.ENSP00000265381	0.730	Amyloid-beta A4 precursor protein-binding family A member 1
17	9606.ENSP00000359782	0.719	BEN domain-containing protein 6
18	9606.ENSP00000340820	0.710	Microtubule-associated protein tau
19	9606.ENSP00000376652	0.710	Ena/VASP-like protein
20	9606.ENSP00000366513	0.703	Calsyntenin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0001540	0.963	amyloid-beta binding
GO:0019899	0.898	enzyme binding
GO:0008134	0.866	transcription factor binding
GO:0044877	0.859	protein-containing complex binding
GO:0140297	0.859	DNA-binding transcription factor binding
GO:0008092	0.849	cytoskeletal protein binding
GO:0048156	0.837	tau protein binding
GO:0044389	0.705	ubiquitin-like protein ligase binding
GO:0031625	0.318	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0080090	0.976	regulation of primary metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.969	positive regulation of cellular process
GO:0009889	0.968	regulation of biosynthetic process
GO:0048523	0.959	negative regulation of cellular process
GO:0050896	0.958	response to stimulus
GO:0045944	0.953	positive regulation of transcription by RNA polymerase II
GO:0008152	0.899	metabolic process
GO:0051716	0.874	cellular response to stimulus
GO:0071704	0.868	organic substance metabolic process
GO:0006950	0.860	response to stress
GO:0009892	0.855	negative regulation of metabolic process
GO:0051172	0.850	negative regulation of nitrogen compound metabolic process
GO:0010605	0.845	negative regulation of macromolecule metabolic process
GO:0031324	0.838	negative regulation of cellular metabolic process
GO:0048583	0.837	regulation of response to stimulus
GO:0006807	0.828	nitrogen compound metabolic process
GO:0043170	0.823	macromolecule metabolic process
GO:0044237	0.814	cellular metabolic process
GO:0044238	0.812	primary metabolic process
GO:0006974	0.810	cellular response to DNA damage stimulus
GO:0010941	0.730	regulation of cell death
GO:0032879	0.706	regulation of localization
GO:0045934	0.672	negative regulation of nucleobase-containing compound metabolic process
GO:0060341	0.671	regulation of cellular localization
GO:0045892	0.663	negative regulation of DNA-templated transcription
GO:0032880	0.633	regulation of protein localization
GO:0042221	0.592	response to chemical
GO:0000122	0.571	negative regulation of transcription by RNA polymerase II
GO:0043067	0.504	regulation of programmed cell death
GO:0071840	0.467	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization
GO:1901564	0.422	organonitrogen compound metabolic process
GO:0032501	0.394	multicellular organismal process
GO:0042981	0.355	regulation of apoptotic process
GO:1901360	0.329	organic cyclic compound metabolic process
GO:0032502	0.311	developmental process
GO:0007275	0.301	multicellular organism development
GO:0048584	0.300	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005654	0.991	nucleoplasm
GO:0005886	0.989	plasma membrane
GO:0030054	0.980	cell junction
GO:0005829	0.930	cytosol
GO:0045202	0.870	synapse
GO:0042995	0.700	cell projection
GO:0120025	0.688	plasma membrane bounded cell projection
GO:0043228	0.614	non-membrane-bounded organelle
GO:0043232	0.574	intracellular non-membrane-bounded organelle
GO:0043005	0.506	neuron projection
GO:0030424	0.438	axon
GO:0005783	0.426	endoplasmic reticulum
GO:0031252	0.425	cell leading edge
GO:1990761	0.379	growth cone lamellipodium
GO:1990812	0.359	growth cone filopodium
GO:0032991	0.334	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]