StarFunc result for job id O00217

User Input

>input (210 residues)
MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLL
WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI
CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE
LLYNKEKLLNNGDKWEAEIAANIQADYLYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42028	0.913	0.905	6.350E-40	212	0.938	0.929	P42028.pdb.gz	NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS8 PE=1 SV=1
2	AFDB:Q8K3J1	0.886	0.878	1.146E-36	212	0.900	0.892	Q8K3J1.pdb.gz	NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs8 PE=1 SV=1
3	AFDB:Q9VF27	0.844	0.817	3.484E-33	217	0.724	0.700	Q9VF27.pdb.gz	NDUS8_DROME NADH dehydrogenase (ubiquinone) 23 kDa subunit OS=Drosophila melanogaster OX=7227 GN=ND-23 PE=1 SV=1
4	PDB:7ak5I	0.807	0.948	1.148E-30	178	0.795	0.938	7ak5I.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
5	AFDB:Q22619	0.836	0.828	2.075E-30	212	0.648	0.642	Q22619.pdb.gz	NDUS8_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=T20H4.5 PE=2 SV=1
6	AFDB:Q42599	0.778	0.736	4.538E-30	222	0.638	0.604	Q42599.pdb.gz	NDS8A_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g79010 PE=1 SV=1
7	PDB:7a23D	0.751	0.887	2.264E-25	177	0.610	0.723	7a23D.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
8	AFDB:P0AFD6	0.561	0.646	1.780E-13	180	0.248	0.289	P0AFD6.pdb.gz	NUOI_ECOLI NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain K12) OX=83333 GN=nuoI PE=1 SV=1
9	AFDB:P9WJG9	0.609	0.606	9.084E-13	211	0.252	0.251	P9WJG9.pdb.gz	NUOI_MYCTU NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoI PE=1 SV=1
10	PDB:7nyrI	0.488	0.642	2.250E-12	158	0.224	0.297	7nyrI.pdb.gz	Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
11	AFDB:P56755	0.566	0.684	6.856E-12	172	0.224	0.273	P56755.pdb.gz	NDHI_ARATH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhI PE=1 SV=1
12	AFDB:P0C384	0.537	0.620	1.708E-11	180	0.224	0.261	P0C384.pdb.gz	NDHI_ORYSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa OX=4530 GN=ndhI PE=3 SV=1
13	PDB:7z0sF	0.399	0.504	1.012E-8	164	0.157	0.201	7z0sF.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
14	AFDB:P16432	0.440	0.507	2.225E-8	180	0.162	0.189	P16432.pdb.gz	HYCF_ECOLI Formate hydrogenlyase subunit 6 OS=Escherichia coli (strain K12) OX=83333 GN=hycF PE=1 SV=1
15	PDB:7wfgI	0.525	0.671	1.373E-7	160	0.214	0.281	7wfgI.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
16	PDB:5exdH	0.261	0.191	1.239E-2	291	0.119	0.086	5exdH.pdb.gz	One-carbon chemistry of oxalate oxidoreductase captured by X-ray crystallography.
17	PDB:6tmfd	0.194	0.082	1.608E-2	582	0.110	0.040	6tmfd.pdb.gz	Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.
18	PDB:5c4iE	0.252	0.173	1.956E-2	312	0.105	0.071	5c4iE.pdb.gz	The Structure of an Oxalate Oxidoreductase Provides Insight into Microbial 2-Oxoacid Metabolism.
19	PDB:1fcaA	0.197	0.695	2.088E-2	55	0.105	0.400	1fcaA.pdb.gz	Structure of the ferredoxin from Clostridium acidurici: model at 1.8 A resolution.
20	PDB:7wfdAC	0.230	0.480	4.277E-2	80	0.110	0.287	7wfdAC.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00217	1.66e-158	438	210	1.000	1.000	NDUS8_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS8 PE=1 SV=1
2	Q8K3J1	9.38e-139	388	212	0.895	0.887	NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs8 PE=1 SV=1
3	P42028	3.10e-137	384	212	0.929	0.920	NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS8 PE=1 SV=1
4	Q9VF27	8.32e-110	315	217	0.695	0.673	NDUS8_DROME NADH dehydrogenase (ubiquinone) 23 kDa subunit OS=Drosophila melanogaster OX=7227 GN=ND-23 PE=1 SV=1
5	Q22619	1.13e-99	289	212	0.676	0.670	NDUS8_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=T20H4.5 PE=2 SV=1
6	Q42599	5.56e-97	283	222	0.614	0.581	NDS8A_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g79010 PE=1 SV=1
7	Q9FX83	1.52e-96	281	222	0.614	0.581	NDS8B_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g16700 PE=1 SV=1
8	P9WJG9	2.27e-27	105	211	0.243	0.242	NUOI_MYCTU NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoI PE=1 SV=1
9	P0AFD6	2.34e-26	101	180	0.243	0.283	NUOI_ECOLI NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain K12) OX=83333 GN=nuoI PE=1 SV=1
10	P56755	7.80e-20	84.7	172	0.248	0.302	NDHI_ARATH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhI PE=1 SV=1
11	P0C384	2.69e-18	80.9	180	0.243	0.283	NDHI_ORYSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa OX=4530 GN=ndhI PE=3 SV=1
12	P0C385	2.69e-18	80.9	180	0.243	0.283	NDHI_ORYSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhI PE=3 SV=1
13	P0C386	2.69e-18	80.9	180	0.243	0.283	NDHI_ORYSJ NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhI PE=3 SV=1
14	Q6ENA3	2.69e-18	80.9	180	0.243	0.283	NDHI_ORYNI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza nivara OX=4536 GN=ndhI PE=3 SV=1
15	P16432	7.99e-10	58.2	180	0.171	0.200	HYCF_ECOLI Formate hydrogenlyase subunit 6 OS=Escherichia coli (strain K12) OX=83333 GN=hycF PE=1 SV=1
16	P00198	1.44e-06	46.2	56	0.124	0.464	FER_GOTA9 4Fe-4S ferredoxin FdxA OS=Gottschalkia acidurici (strain ATCC 7906 / DSM 604 / BCRC 14475 / CIP 104303 / KCTC 5404 / NCIMB 10678 / 9a) OX=1128398 GN=fdxA PE=1 SV=3
17	Q72AR1	7.23e-06	46.6	147	0.110	0.156	Q72AR1_DESVH Iron-sulfur cluster-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1931 PE=1 SV=1
18	Q46507	1.13e-04	44.7	490	0.105	0.045	HNDC_SOLFR NADP-reducing hydrogenase subunit HndC OS=Solidesulfovibrio fructosivorans OX=878 GN=hndC PE=1 SV=1
19	H6LGM8	3.22e-04	43.1	396	0.105	0.056	CARE_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarE OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carE PE=1 SV=1
20	P00194	4.89e-04	39.3	55	0.105	0.400	FER1_RHORU Ferredoxin-1 OS=Rhodospirillum rubrum OX=1085 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08782 c-SKI_SMAD_bind	49	15.5	c-SKI Smad4 binding domain
2	PF00037 Fer4	1.4e-10	51.7	4Fe-4S binding domain
3	PF13237 Fer4_10	6.6e-05	34.2	4Fe-4S dicluster domain
4	PF13370 Fer4_13	1.4e+02	14.4	4Fe-4S single cluster domain of Ferredoxin I
5	PF13484 Fer4_16	1.3e-07	43.8	4Fe-4S double cluster binding domain
6	PF13534 Fer4_17	1.5	20.7	4Fe-4S dicluster domain
7	PF13746 Fer4_18	86	14.8	4Fe-4S dicluster domain
8	PF12797 Fer4_2	0.039	25.2	4Fe-4S binding domain
9	PF14697 Fer4_21	1.2e-05	36.6	4Fe-4S dicluster domain
10	PF12798 Fer4_3	4.9e+02	13.2	4Fe-4S binding domain
11	PF12800 Fer4_4	0.1	24.2	4Fe-4S binding domain
12	PF12837 Fer4_6	0.0016	29.6	4Fe-4S binding domain
13	PF12838 Fer4_7	3.4e-09	48.4	4Fe-4S dicluster domain
14	PF13183 Fer4_8	0.00099	30.8	4Fe-4S dicluster domain
15	PF13187 Fer4_9	0.00012	33.4	4Fe-4S dicluster domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315774

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
2	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
3	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
4	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
5	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
6	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
7	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
8	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
9	9606.ENSP00000276062	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
10	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
11	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
12	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
13	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
14	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
15	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
16	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
17	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
18	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
19	9606.ENSP00000362873	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
20	9606.ENSP00000369176	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.942	catalytic activity
GO:0016491	0.930	oxidoreductase activity
GO:0022857	0.588	transmembrane transporter activity
GO:0022804	0.542	active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006979	0.990	response to oxidative stress
GO:0006091	0.985	generation of precursor metabolites and energy
GO:0009060	0.978	aerobic respiration
GO:0033108	0.960	mitochondrial respiratory chain complex assembly
GO:0010257	0.955	NADH dehydrogenase complex assembly
GO:0032981	0.954	mitochondrial respiratory chain complex I assembly
GO:0022904	0.942	respiratory electron transport chain
GO:0006119	0.941	oxidative phosphorylation
GO:0042773	0.887	ATP synthesis coupled electron transport
GO:0042775	0.866	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.540	aerobic electron transport chain
GO:0006120	0.493	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005747	0.997	mitochondrial respiratory chain complex I
GO:0070013	0.849	intracellular organelle lumen
GO:0005759	0.452	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.930	Oxidoreductases.

[back to server]