StarFunc result for job id O00220

User Input

>input (468 residues)
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00220	1.000	1.000	6.759E-82	468	1.000	1.000	O00220.pdb.gz	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
2	AFDB:O14763	0.261	0.276	1.523E-38	440	0.487	0.518	O14763.pdb.gz	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
3	AFDB:Q9UBN6	0.229	0.276	1.170E-22	386	0.338	0.409	Q9UBN6.pdb.gz	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
4	AFDB:Q641J8	0.085	0.068	6.249E-4	622	0.147	0.111	Q641J8.pdb.gz	RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis OX=8355 GN=rnf12-a PE=1 SV=1
5	AFDB:Q12215	0.074	0.064	4.704E-3	556	0.096	0.081	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
6	AFDB:Q6TXD4	0.083	0.033	1.177E-2	1580	0.171	0.051	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
7	AFDB:A0A0S2Z470	0.082	0.083	2.042E-2	459	0.137	0.139	A0A0S2Z470.pdb.gz	A0A0S2Z470_HUMAN Papillary renal cell carcinoma isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1
8	PDB:2gf5A	0.165	0.352	2.480E-2	191	0.049	0.120	2gf5A.pdb.gz
9	AFDB:Q7JR75	0.062	0.040	5.433E-2	824	0.130	0.074	Q7JR75.pdb.gz	Q7JR75_DROME CAP, isoform C OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
10	AFDB:Q555V8	0.073	0.040	1.360E-1	1112	0.141	0.059	Q555V8.pdb.gz	Q555V8_DICDI Acetylglutamate kinase OS=Dictyostelium discoideum OX=44689 GN=argB PE=4 SV=2
11	AFDB:Q9VIW0	0.067	0.063	1.446E-1	511	0.165	0.151	Q9VIW0.pdb.gz	Q9VIW0_DROME Traffic jam, isoform B OS=Drosophila melanogaster OX=7227 GN=tj PE=4 SV=3
12	PDB:2kn6A	0.126	0.254	3.659E-1	195	0.038	0.092	2kn6A.pdb.gz
13	PDB:7r5vN	0.128	0.192	5.614E-1	297	0.026	0.040	7r5vN.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
14	PDB:2kr0A	0.093	0.103	6.344E-1	407	0.079	0.091	2kr0A.pdb.gz
15	PDB:5n9jE	0.064	0.123	6.745E-1	201	0.038	0.090	5n9jE.pdb.gz
16	PDB:5juyB	0.149	0.062	7.622E-1	1234	0.030	0.011	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
17	PDB:6wfqC	0.065	0.107	7.622E-1	228	0.034	0.070	6wfqC.pdb.gz	Mechanism of NanR gene repression and allosteric induction of bacterial sialic acid metabolism.
18	PDB:6p6cA	0.141	0.493	8.103E-1	90	0.028	0.144	6p6cA.pdb.gz
19	PDB:7bxtM	0.122	0.257	9.157E-1	198	0.013	0.030	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
20	PDB:4ob3B	0.077	0.130	1.243	229	0.032	0.066	4ob3B.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00220	0.0	963	468	1.000	1.000	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
2	O14763	1.53e-125	374	440	0.494	0.525	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
3	Q9UBN6	2.22e-78	251	386	0.402	0.487	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
4	A0A0G2JZE1	8.79e-60	201	336	0.284	0.396	A0A0G2JZE1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
5	A0A1W2Q6I0	9.97e-60	201	331	0.284	0.402	A0A1W2Q6I0_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
6	B8YBG7	2.54e-59	199	336	0.282	0.393	B8YBG7_RAT Tumor necrosis factor receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=2 SV=1
7	O14798	4.26e-54	183	259	0.199	0.359	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
8	D3ZYZ1	1.73e-29	118	267	0.122	0.213	D3ZYZ1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=5
9	Q9DF34	1.76e-22	100	357	0.192	0.252	Q9DF34_DANRE Death receptor OS=Danio rerio OX=7955 GN=zgc:103531 PE=2 SV=1
10	F1QD95	7.21e-22	99.8	418	0.205	0.230	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
11	Q0PKX6	2.28e-10	64.7	436	0.092	0.099	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
12	Q9ER62	1.08e-07	54.3	198	0.066	0.157	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3
13	P25445	4.74e-07	53.9	335	0.094	0.131	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
14	K9J972	2.43e-06	50.4	197	0.090	0.213	K9J972_HUMAN FAS receptor variant 9 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
15	Q9ER63	1.02e-05	48.1	176	0.058	0.153	TNR23_MOUSE Tumor necrosis factor receptor superfamily member 23 OS=Mus musculus OX=10090 GN=Tnfrsf23 PE=2 SV=2
16	Q71F55	2.53e-05	48.1	276	0.100	0.170	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
17	F1QG24	3.27e-05	48.1	293	0.113	0.181	F1QG24_DANRE Tumor necrosis factor receptor superfamily member 6 OS=Danio rerio OX=7955 GN=fas PE=4 SV=1
18	Q80WM9	9.21e-05	46.6	275	0.098	0.167	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
19	O00300	2.86e-04	45.4	401	0.075	0.087	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
20	P25446	3.30e-04	45.1	327	0.071	0.101	TNR6_MOUSE Tumor necrosis factor receptor superfamily member 6 OS=Mus musculus OX=10090 GN=Fas PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	4.3e-15	66.9	Death domain
2	PF20481 DUF6721	72	15.1	Domain of unknown function (DUF6721)
3	PF00020 TNFR_c6	8.5e-14	63.0	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221132

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241261	0.999	Tumor necrosis factor ligand superfamily member 10
2	9606.ENSP00000301838	0.999	FAS-associated death domain protein
3	9606.ENSP00000351273	0.999	Caspase-8
4	9606.ENSP00000286186	0.991	Caspase-10
5	9606.ENSP00000341268	0.987	Tumor necrosis factor receptor type 1-associated DEATH domain protein
6	9606.ENSP00000312455	0.985	CASP8 and FADD-like apoptosis regulator
7	9606.ENSP00000276431	0.979	Tumor necrosis factor receptor superfamily member 10B
8	9606.ENSP00000311032	0.977	Caspase-3
9	9606.ENSP00000259808	0.970	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000269305	0.970	Cellular tumor antigen p53
11	9606.ENSP00000011653	0.957	T-cell surface glycoprotein CD4
12	9606.ENSP00000247668	0.954	TNF receptor-associated factor 2
13	9606.ENSP00000398698	0.950	Tumor necrosis factor
14	9606.ENSP00000318822	0.944	BH3-interacting domain death agonist
15	9606.ENSP00000216274	0.937	Receptor-interacting serine/threonine-protein kinase 3
16	9606.ENSP00000356694	0.930	Tumor necrosis factor ligand superfamily member 6
17	9606.ENSP00000357320	0.930	28S ribosomal protein S29, mitochondrial
18	9606.ENSP00000430684	0.930	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000359424	0.929	Inhibitor of nuclear factor kappa-B kinase subunit alpha
20	9606.ENSP00000367013	0.929	Tumor necrosis factor receptor superfamily member 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005035	1.000	death receptor activity
GO:0002020	1.000	protease binding
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.995	signal transduction
GO:0008219	0.939	cell death
GO:0009612	0.905	response to mechanical stimulus
GO:0071260	0.899	cellular response to mechanical stimulus
GO:0097190	0.896	apoptotic signaling pathway
GO:0007166	0.875	cell surface receptor signaling pathway
GO:0097191	0.799	extrinsic apoptotic signaling pathway
GO:0048518	0.783	positive regulation of biological process
GO:0048522	0.760	positive regulation of cellular process
GO:0008625	0.715	extrinsic apoptotic signaling pathway via death domain receptors
GO:0048583	0.511	regulation of response to stimulus
GO:0048584	0.416	positive regulation of response to stimulus
GO:0006950	0.364	response to stress
GO:0009966	0.346	regulation of signal transduction
GO:0048519	0.331	negative regulation of biological process
GO:0042221	0.306	response to chemical
GO:0009967	0.303	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005829	0.993	cytosol
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0009986	0.946	cell surface
GO:0005794	0.705	Golgi apparatus
GO:0098857	0.457	membrane microdomain
GO:0045121	0.437	membrane raft
GO:0005634	0.423	nucleus
GO:0043233	0.320	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]