StarFunc result for job id O00221

User Input

>input (500 residues)
MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRG
GGPAWAVRLPTVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAAR
RSLEPDPAQTGPRPARAAGMSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPS
DGSPQPCTHPPGPVKEPQEKEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPH
VGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHL
AVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHS
LDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
LVLLPFDDLKISGKLLLCTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD24	0.576	0.576	7.863E-57	500	1.000	1.000	A0A024RD24.pdb.gz
2	AFDB:Q6P780	0.484	0.659	4.406E-38	365	0.588	0.805	Q6P780.pdb.gz	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
3	PDB:8cs9A	0.406	0.259	1.333E-11	796	0.128	0.080	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:A1DRY3	0.301	0.197	1.457E-11	782	0.194	0.124	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
5	PDB:2dvwA	0.388	0.804	5.229E-10	229	0.102	0.223	2dvwA.pdb.gz
6	AFDB:A2ABF8	0.394	0.166	6.849E-10	1233	0.192	0.078	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
7	AFDB:Q9H9B1	0.387	0.160	1.234E-9	1298	0.238	0.092	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
8	AFDB:A2ABF9	0.392	0.161	3.498E-9	1267	0.194	0.077	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
9	AFDB:A8TT22	0.393	0.176	6.596E-9	1173	0.206	0.088	A8TT22.pdb.gz	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
10	PDB:6v9hC	0.355	0.631	1.790E-8	270	0.116	0.215	6v9hC.pdb.gz
11	PDB:4oauC	0.284	0.217	2.816E-8	692	0.098	0.071	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
12	PDB:5vkqA	0.216	0.098	3.083E-8	1499	0.136	0.045	5vkqA.pdb.gz
13	PDB:1wg0A	0.362	0.700	8.739E-8	243	0.100	0.206	1wg0A.pdb.gz
14	PDB:6aunA	0.326	0.274	1.256E-7	618	0.132	0.107	6aunA.pdb.gz
15	PDB:6jd6B	0.284	0.708	3.251E-7	192	0.086	0.224	6jd6B.pdb.gz
16	PDB:6mwqA	0.282	0.286	7.687E-7	493	0.100	0.101	6mwqA.pdb.gz
17	PDB:6e2fC	0.317	0.250	2.733E-6	647	0.106	0.082	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
18	AFDB:Q90X95	0.276	0.189	5.423E-5	772	0.138	0.089	Q90X95.pdb.gz	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
19	AFDB:Q5DU14	0.196	0.067	2.208E-4	1919	0.122	0.032	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
20	AFDB:Q8CGN4	0.236	0.071	1.415E-3	1759	0.176	0.050	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ASQ1	0.0	524	358	0.554	0.774	A0A8I6ASQ1_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=1 SV=1
2	O00221	0.0	992	500	1.000	1.000	IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=3
3	O54910	0.0	554	364	0.592	0.813	IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus OX=10090 GN=Nfkbie PE=1 SV=2
4	Q6P780	0.0	556	365	0.588	0.805	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
5	Q7LC14	0.0	718	361	0.722	1.000	Q7LC14_HUMAN NFKB inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=1
6	Q9Z2F6	5.40e-46	168	448	0.194	0.217	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
7	P20749	8.37e-45	165	454	0.204	0.225	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
8	H7C0A2	4.22e-44	159	308	0.204	0.331	H7C0A2_HUMAN BCL3 transcription coactivator (Fragment) OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=1
9	Q08353	6.82e-36	137	314	0.192	0.306	IKBA_PIG NF-kappa-B inhibitor alpha OS=Sus scrofa OX=9823 GN=NFKBIA PE=1 SV=1
10	P25963	8.27e-35	134	317	0.188	0.297	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
11	E7FFI8	3.61e-34	138	619	0.168	0.136	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
12	Q20KN0	4.44e-34	135	439	0.170	0.194	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
13	Q63746	1.14e-33	131	314	0.188	0.299	IKBA_RAT NF-kappa-B inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Nfkbia PE=2 SV=1
14	Q9Z1E3	1.20e-33	131	314	0.188	0.299	IKBA_MOUSE NF-kappa-B inhibitor alpha OS=Mus musculus OX=10090 GN=Nfkbia PE=1 SV=2
15	F1QCG4	1.27e-32	128	310	0.156	0.252	F1QCG4_DANRE Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha a OS=Danio rerio OX=7955 GN=fj16a07 PE=4 SV=1
16	Q9JIA3	1.37e-32	129	359	0.184	0.256	IKBB_RAT NF-kappa-B inhibitor beta OS=Rattus norvegicus OX=10116 GN=Nfkbib PE=1 SV=1
17	Q60778	1.74e-31	126	359	0.172	0.240	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
18	Q04861	2.92e-31	130	983	0.160	0.081	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
19	Q15653	4.14e-31	125	356	0.170	0.239	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2
20	Q00653	1.51e-30	128	900	0.182	0.101	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.4e-16	70.6	Ankyrin repeat
2	PF12796 Ank_2	5.4e-27	105.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-13	59.9	Ankyrin repeat
4	PF13637 Ank_4	1.8e-14	65.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.1e-12	59.1	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384273	0.998	Transcription factor p65
2	9606.ENSP00000295025	0.997	Proto-oncogene c-Rel
3	9606.ENSP00000359424	0.974	Inhibitor of nuclear factor kappa-B kinase subunit alpha
4	9606.ENSP00000483825	0.972	NF-kappa-B essential modulator
5	9606.ENSP00000430684	0.967	Inhibitor of nuclear factor kappa-B kinase subunit beta
6	9606.ENSP00000221452	0.954	Transcription factor RelB
7	9606.ENSP00000226574	0.932	Nuclear factor NF-kappa-B p105 subunit
8	9606.ENSP00000272317	0.915	Ubiquitin-40S ribosomal protein S27a
9	9606.ENSP00000441543	0.912	Polyubiquitin-C
10	9606.ENSP00000304697	0.911	Polyubiquitin-B
11	9606.ENSP00000388107	0.907	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000392147	0.894	Protein phosphatase 6 catalytic subunit
13	9606.ENSP00000216797	0.871	NF-kappa-B inhibitor alpha
14	9606.ENSP00000312988	0.861	NF-kappa-B inhibitor beta
15	9606.ENSP00000478417	0.857	Serine/threonine-protein phosphatase 6 regulatory subunit 2
16	9606.ENSP00000414202	0.841	Serine/threonine-protein phosphatase 6 regulatory subunit 1
17	9606.ENSP00000380150	0.796	Caspase recruitment domain-containing protein 11
18	9606.ENSP00000359206	0.792	F-box/WD repeat-containing protein 1A
19	9606.ENSP00000359612	0.772	B-cell lymphoma/leukemia 10
20	9606.ENSP00000358335	0.759	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0009987	0.984	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0051090	0.962	regulation of DNA-binding transcription factor activity
GO:0044092	0.919	negative regulation of molecular function
GO:0051235	0.904	maintenance of location
GO:0045185	0.888	maintenance of protein location
GO:0043433	0.816	negative regulation of DNA-binding transcription factor activity
GO:0050896	0.552	response to stimulus
GO:0048518	0.544	positive regulation of biological process
GO:0048522	0.434	positive regulation of cellular process
GO:0051716	0.360	cellular response to stimulus
GO:0048519	0.314	negative regulation of biological process
GO:0048583	0.311	regulation of response to stimulus
GO:0009893	0.309	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0001650	0.988	fibrillar center
GO:0032991	0.301	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]