StarFunc result for job id O00222

User Input

>input (908 residues)
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F6P3F9	0.827	0.826	0.000	909	0.713	0.712	F6P3F9.pdb.gz
2	AFDB:O00222	1.000	1.000	0.000	908	1.000	1.000	O00222.pdb.gz	GRM8_HUMAN Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2
3	AFDB:O15303	0.825	0.853	0.000	877	0.665	0.689	O15303.pdb.gz	GRM6_HUMAN Metabotropic glutamate receptor 6 OS=Homo sapiens OX=9606 GN=GRM6 PE=1 SV=2
4	AFDB:P31423	0.918	0.914	0.000	912	0.748	0.745	P31423.pdb.gz	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
5	AFDB:P35400	0.910	0.903	0.000	915	0.733	0.728	P35400.pdb.gz	GRM7_RAT Metabotropic glutamate receptor 7 OS=Rattus norvegicus OX=10116 GN=Grm7 PE=1 SV=1
6	AFDB:P31422	0.860	0.887	9.867E-94	879	0.435	0.449	P31422.pdb.gz	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
7	PDB:7e9hR	0.714	0.830	7.057E-92	766	0.671	0.795	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
8	AFDB:P31421	0.846	0.879	3.378E-90	872	0.425	0.443	P31421.pdb.gz	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
9	PDB:7epcA	0.742	0.850	6.005E-90	782	0.665	0.772	7epcA.pdb.gz
10	AFDB:P91685	0.836	0.780	7.145E-90	976	0.461	0.429	P91685.pdb.gz	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2
11	AFDB:A1Z7F5	0.811	0.600	5.975E-85	1248	0.402	0.292	A1Z7F5.pdb.gz	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
12	AFDB:P41594	0.815	0.620	4.377E-83	1212	0.400	0.300	P41594.pdb.gz	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
13	PDB:7e9gR	0.722	0.839	4.657E-72	769	0.407	0.481	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
14	PDB:7epaA	0.678	0.772	8.188E-66	782	0.401	0.465	7epaA.pdb.gz
15	PDB:7wihA	0.710	0.855	4.673E-64	741	0.390	0.478	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
16	PDB:7dtvA	0.707	0.812	3.376E-51	779	0.265	0.309	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
17	PDB:7c7sA	0.363	0.470	1.430E-32	685	0.151	0.200	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
18	PDB:6w2xB	0.335	0.443	7.256E-28	669	0.152	0.206	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
19	PDB:6ffhA	0.259	0.560	1.942E-16	414	0.137	0.300	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
20	PDB:4pe5C	0.316	0.373	3.364E-16	754	0.084	0.101	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KF15	707	1472	0.402	0.248	A0A0B4KF15_DROME Mangetout, isoform G OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
2	A1IMB8	590	1008	0.366	0.329	A1IMB8_CAEEL G-protein coupled receptors family 3 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mgl-3 PE=3 SV=3
3	A1L1T5	1381	905	0.710	0.713	A1L1T5_DANRE Glutamate receptor, metabotropic 6b OS=Danio rerio OX=7955 GN=cb496 PE=2 SV=1
4	A1Z7F4	710	1095	0.402	0.333	A1Z7F4_DROME Mangetout, isoform E OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
5	A1Z7F5	706	1248	0.402	0.292	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
6	B7YZT0	707	1415	0.402	0.258	B7YZT0_DROME Mangetout, isoform D OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
7	H0ZKH5	646	1184	0.395	0.303	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
8	H0ZRP5	675	1243	0.403	0.294	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
9	O00222	1895	908	1.000	1.000	GRM8_HUMAN Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2
10	O15303	1260	877	0.663	0.686	GRM6_HUMAN Metabotropic glutamate receptor 6 OS=Homo sapiens OX=9606 GN=GRM6 PE=1 SV=2
11	P23385	645	1199	0.395	0.299	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
12	P31421	719	872	0.428	0.446	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
13	P31422	768	879	0.435	0.449	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
14	P31423	1421	912	0.742	0.739	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
15	P31424	666	1203	0.402	0.303	GRM5_RAT Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2
16	P35349	1215	871	0.659	0.687	GRM6_RAT Metabotropic glutamate receptor 6 OS=Rattus norvegicus OX=10116 GN=Grm6 PE=2 SV=1
17	P35400	1429	915	0.733	0.728	GRM7_RAT Metabotropic glutamate receptor 7 OS=Rattus norvegicus OX=10116 GN=Grm7 PE=1 SV=1
18	P41594	671	1212	0.402	0.301	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
19	P47743	1872	908	0.985	0.985	GRM8_MOUSE Metabotropic glutamate receptor 8 OS=Mus musculus OX=10090 GN=Grm8 PE=1 SV=2
20	P70579	1871	908	0.986	0.986	GRM8_RAT Metabotropic glutamate receptor 8 OS=Rattus norvegicus OX=10116 GN=Grm8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	1.3e-55	200.5	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF01094 ANF_receptor	2.2e-103	357.7	Receptor family ligand binding region
3	PF07562 NCD3G	1.3e-10	52.3	Nine Cysteines Domain of family 3 GPCR
4	PF13458 Peripla_BP_6	0.006	28.0	Periplasmic binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344173

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440556	0.835	Metabotropic glutamate receptor 4
2	9606.ENSP00000350348	0.808	Metabotropic glutamate receptor 7
3	9606.ENSP00000360141	0.759	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
4	9606.ENSP00000359506	0.758	Synaptic functional regulator FMR1
5	9606.ENSP00000366233	0.709	Gamma-aminobutyric acid type B receptor subunit 1
6	9606.ENSP00000259455	0.703	Gamma-aminobutyric acid type B receptor subunit 2
7	9606.ENSP00000379818	0.699	Glutamate receptor ionotropic, NMDA 2A
8	9606.ENSP00000428994	0.691	Glutamate receptor 1
9	9606.ENSP00000382428	0.678	Disks large homolog 4
10	9606.ENSP00000309493	0.669	G-protein coupled receptor family C group 6 member A
11	9606.ENSP00000296526	0.668	Glutamate receptor 2
12	9606.ENSP00000435648	0.668	Glutamate receptor ionotropic, kainate 4
13	9606.ENSP00000481554	0.664	Glutamate receptor 3
14	9606.ENSP00000355155	0.662	Glutamate receptor ionotropic, NMDA 3A
15	9606.ENSP00000423917	0.661	Neuropeptide Y receptor type 5
16	9606.ENSP00000371932	0.651	Taste receptor type 2 member 1
17	9606.ENSP00000448219	0.649	Taste receptor type 2 member 38
18	9606.ENSP00000477455	0.648	Glutamate receptor ionotropic, NMDA 2B
19	9606.ENSP00000223026	0.643	Hyaluronidase-4
20	9606.ENSP00000334382	0.643	Homer protein homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008066	0.999	glutamate receptor activity
GO:0004930	0.999	G protein-coupled receptor activity
GO:0005488	0.987	binding
GO:0005515	0.968	protein binding
GO:0098988	0.443	G protein-coupled glutamate receptor activity
GO:0001640	0.333	adenylate cyclase inhibiting G protein-coupled glutamate receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0050794	0.987	regulation of cellular process
GO:0032501	0.983	multicellular organismal process
GO:0007600	0.934	sensory perception
GO:0007186	0.925	G protein-coupled receptor signaling pathway
GO:0007268	0.908	chemical synaptic transmission
GO:0007215	0.828	glutamate receptor signaling pathway
GO:0007188	0.702	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0035249	0.593	synaptic transmission, glutamatergic
GO:0007193	0.397	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.688	organelle
GO:0005622	0.616	intracellular anatomical structure
GO:0043005	0.591	neuron projection
GO:0098590	0.558	plasma membrane region
GO:0097060	0.512	synaptic membrane
GO:0005737	0.370	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]