StarFunc result for job id O00231

User Input

>input (422 residues)
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00231	1.000	1.000	3.652E-52	422	1.000	1.000	O00231.pdb.gz	PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3
2	PDB:5l4kQ	0.829	0.829	2.229E-39	422	1.000	1.000	5l4kQ.pdb.gz
3	AFDB:Q7KLV9	0.953	0.953	1.650E-37	422	0.680	0.680	Q7KLV9.pdb.gz	PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster OX=7227 GN=Rpn6 PE=1 SV=1
4	AFDB:Q9P7S2	0.877	0.879	2.041E-34	421	0.545	0.546	Q9P7S2.pdb.gz	RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn6 PE=3 SV=1
5	AFDB:Q9LP45	0.925	0.931	4.561E-33	419	0.509	0.513	Q9LP45.pdb.gz	PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN6 PE=1 SV=1
6	AFDB:Q20938	0.849	0.820	1.035E-32	438	0.509	0.491	Q20938.pdb.gz	PS11A_CAEEL Probable 26S proteasome regulatory subunit rpn-6.1 OS=Caenorhabditis elegans OX=6239 GN=rpn-6.1 PE=2 SV=2
7	PDB:3txmA	0.818	0.975	2.780E-31	353	0.590	0.705	3txmA.pdb.gz
8	AFDB:Q54UB5	0.855	0.873	1.245E-30	413	0.495	0.506	Q54UB5.pdb.gz	PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum OX=44689 GN=psmD11 PE=2 SV=1
9	AFDB:Q12377	0.909	0.885	1.374E-28	434	0.424	0.412	Q12377.pdb.gz	RPN6_YEAST 26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN6 PE=1 SV=3
10	AFDB:Q586L6	0.859	0.714	9.033E-27	513	0.396	0.326	Q586L6.pdb.gz	Q586L6_TRYB2 Proteasome regulatory non-ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.45 PE=3 SV=1
11	PDB:5mpbQ	0.789	0.769	1.358E-21	434	0.424	0.412	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
12	AFDB:P61201	0.562	0.539	1.944E-17	443	0.230	0.219	P61201.pdb.gz	CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1
13	AFDB:Q8W207	0.538	0.520	6.793E-17	439	0.197	0.189	Q8W207.pdb.gz	CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CSN2 PE=1 SV=1
14	PDB:6r7nB	0.531	0.512	4.256E-14	443	0.230	0.219	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
15	PDB:5gjr6	0.430	0.431	8.074E-8	421	0.156	0.157	5gjr6.pdb.gz	An atomic structure of the human 26S proteasome.
16	PDB:6fvtR	0.462	0.477	8.802E-8	405	0.114	0.119	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
17	PDB:5l4kR	0.471	0.502	3.076E-7	389	0.130	0.141	5l4kR.pdb.gz
18	PDB:5mpbP	0.442	0.427	9.447E-7	440	0.149	0.143	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:6fyxo	0.402	0.338	1.454E-6	529	0.164	0.130	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:3jckD	0.463	0.498	1.805E-6	384	0.118	0.130	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00231	0.0	856	422	1.000	1.000	PSD11_HUMAN 26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3
2	Q7KLV9	0.0	587	422	0.682	0.682	PSD11_DROME 26S proteasome non-ATPase regulatory subunit 11 OS=Drosophila melanogaster OX=7227 GN=Rpn6 PE=1 SV=1
3	Q8BG32	0.0	854	422	0.998	0.998	PSD11_MOUSE 26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus OX=10090 GN=Psmd11 PE=1 SV=3
4	Q9P7S2	3.88e-163	467	421	0.543	0.544	RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn6 PE=3 SV=1
5	Q20938	1.78e-142	415	438	0.505	0.486	PS11A_CAEEL Probable 26S proteasome regulatory subunit rpn-6.1 OS=Caenorhabditis elegans OX=6239 GN=rpn-6.1 PE=2 SV=2
6	Q54UB5	2.27e-141	411	413	0.488	0.499	PSD11_DICDI 26S proteasome non-ATPase regulatory subunit 11 OS=Dictyostelium discoideum OX=44689 GN=psmD11 PE=2 SV=1
7	Q9LP45	4.32e-137	400	419	0.507	0.511	PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN6 PE=1 SV=1
8	Q12377	8.10e-112	337	434	0.417	0.406	RPN6_YEAST 26S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN6 PE=1 SV=3
9	Q586L6	3.54e-84	268	513	0.370	0.304	Q586L6_TRYB2 Proteasome regulatory non-ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.45 PE=3 SV=1
10	Q8WRU5	3.85e-84	268	513	0.370	0.304	Q8WRU5_9TRYP Proteasome regulatory non-ATP-ase subunit 6 OS=Trypanosoma brucei OX=5691 GN=Rpn6 PE=2 SV=1
11	P61201	5.09e-25	108	443	0.213	0.203	CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1
12	P61202	5.09e-25	108	443	0.213	0.203	CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus OX=10090 GN=Cops2 PE=1 SV=1
13	P61203	5.09e-25	108	443	0.213	0.203	CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Cops2 PE=1 SV=1
14	Q54HL6	7.53e-24	105	449	0.216	0.203	CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=csn2 PE=1 SV=1
15	Q8W207	5.34e-19	90.9	439	0.190	0.182	CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CSN2 PE=1 SV=1
16	Q94899	3.86e-18	88.2	444	0.194	0.185	CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=alien PE=1 SV=2
17	Q5B3U7	1.47e-16	84.0	506	0.185	0.154	CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=csnB PE=1 SV=2
18	O01422	1.55e-16	83.6	495	0.194	0.166	CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=csn-2 PE=1 SV=2
19	Q9HFR0	9.53e-12	68.6	437	0.135	0.130	CSN2_SCHPO COP9 signalosome complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn2 PE=1 SV=1
20	Q9GS00	6.90e-04	44.3	601	0.045	0.032	CSN1_CAEEL COP9 signalosome complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=csn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09756 DDRGK	18	16.4	DDRGK domain
2	PF09921 DUF2153	90	14.3	Uncharacterized protein conserved in archaea (DUF2153)
3	PF01399 PCI	1.5e-17	75.4	PCI domain
4	PF18503 RPN6_C_helix	4.4e-13	60.0	26S proteasome subunit RPN6 C-terminal helix domain
5	PF18055 RPN6_N	4.9e-31	118.9	26S proteasome regulatory subunit RPN6 N-terminal domain
6	PF13424 TPR_12	2.9	19.6	Tetratricopeptide repeat
7	PF07719 TPR_2	2.4e+02	13.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007452429.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007445734.1	0.999	26S proteasome non-ATPase regulatory subunit 6 isoform X1
2	118797.XP_007445990.1	0.999	Proteasome subunit beta type-1
3	118797.XP_007446020.1	0.999	Proteasome 26S subunit, ATPase 6
4	118797.XP_007449384.1	0.999	Proteasome subunit alpha type-5 isoform X1
5	118797.XP_007449978.1	0.999	26S proteasome non-ATPase regulatory subunit 7-like
6	118797.XP_007450311.1	0.999	Proteasome subunit beta type-7
7	118797.XP_007453899.1	0.999	Proteasome subunit beta 2
8	118797.XP_007455793.1	0.999	Belongs to the AAA ATPase family.
9	118797.XP_007456828.1	0.999	Proteasome 26S subunit, ATPase 5
10	118797.XP_007456850.1	0.999	26S proteasome non-ATPase regulatory subunit 12-like isoform X1
11	118797.XP_007457064.1	0.999	26S proteasome non-ATPase regulatory subunit 14
12	118797.XP_007458721.1	0.999	Proteasome 26S subunit, ATPase 4
13	118797.XP_007460277.1	0.999	Proteasome subunit alpha 1
14	118797.XP_007460323.1	0.999	Proteasome 26S subunit, non-ATPase 4
15	118797.XP_007460333.1	0.999	Belongs to the peptidase T1B family.
16	118797.XP_007462802.1	0.999	26S proteasome non-ATPase regulatory subunit 1 isoform X1
17	118797.XP_007464884.1	0.999	Proteasome subunit alpha 6
18	118797.XP_007465205.1	0.999	Proteasome subunit beta type-3
19	118797.XP_007465242.1	0.999	26S proteasome non-ATPase regulatory subunit 3
20	118797.XP_007465968.1	0.999	26S proteasome non-ATPase regulatory subunit 13 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:0044237	0.990	cellular metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0030163	0.975	protein catabolic process
GO:0044260	0.952	cellular macromolecule metabolic process
GO:0071840	0.940	cellular component organization or biogenesis
GO:0044265	0.910	cellular macromolecule catabolic process
GO:0006508	0.793	proteolysis
GO:0016043	0.773	cellular component organization
GO:0044085	0.753	cellular component biogenesis
GO:0043632	0.745	modification-dependent macromolecule catabolic process
GO:0051603	0.542	proteolysis involved in protein catabolic process
GO:0019941	0.437	modification-dependent protein catabolic process
GO:0006511	0.416	ubiquitin-dependent protein catabolic process
GO:0043933	0.389	protein-containing complex organization
GO:0065003	0.378	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0022624	0.997	proteasome accessory complex
GO:0005654	0.997	nucleoplasm
GO:0016020	0.989	membrane
GO:0012505	0.975	endomembrane system
GO:0005576	0.970	extracellular region
GO:0031982	0.934	vesicle
GO:0005615	0.674	extracellular space
GO:0005838	0.449	proteasome regulatory particle
GO:0070062	0.426	extracellular exosome
GO:0099503	0.421	secretory vesicle
GO:0101002	0.381	ficolin-1-rich granule
GO:1904813	0.369	ficolin-1-rich granule lumen
GO:0034774	0.356	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]