StarFunc result for job id O00233

User Input

>input (223 residues)
MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM
SRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVV
QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00233	1.000	1.000	4.872E-41	223	1.000	1.000	O00233.pdb.gz	PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 PE=1 SV=3
2	AFDB:Q9WTV5	0.776	0.779	8.680E-34	222	0.821	0.824	Q9WTV5.pdb.gz	PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus OX=10116 GN=Psmd9 PE=1 SV=1
3	AFDB:Q9VFS8	0.409	0.415	2.133E-22	220	0.381	0.386	Q9VFS8.pdb.gz	PSMD9_DROME 26S proteasome non-ATPase regulatory subunit 9 OS=Drosophila melanogaster OX=7227 GN=CG9588 PE=1 SV=1
4	AFDB:Q10920	0.400	0.452	7.246E-20	197	0.296	0.335	Q10920.pdb.gz	PSMD9_CAEEL Probable 26S proteasome non-ATPase regulatory subunit 9 OS=Caenorhabditis elegans OX=6239 GN=psmd-9 PE=1 SV=2
5	AFDB:Q57X08	0.409	0.410	4.214E-19	222	0.296	0.297	Q57X08.pdb.gz	Q57X08_TRYB2 Proteasome 26S non-ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.470 PE=4 SV=1
6	AFDB:P40555	0.389	0.394	3.125E-18	220	0.336	0.341	P40555.pdb.gz	PSMD9_YEAST Probable 26S proteasome regulatory subunit p27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAS2 PE=1 SV=1
7	AFDB:O94393	0.364	0.381	6.533E-16	213	0.291	0.305	O94393.pdb.gz	PSMD9_SCHPO Probable 26S proteasome regulatory subunit p27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nas2 PE=3 SV=1
8	AFDB:A0A1P8BA81	0.385	0.336	5.469E-15	256	0.251	0.219	A0A1P8BA81.pdb.gz	A0A1P8BA81_ARATH 26S proteasome regulatory subunit OS=Arabidopsis thaliana OX=3702 GN=MTI20.21 PE=1 SV=1
9	AFDB:P0AEH1	0.309	0.160	2.280E-7	450	0.126	0.062	P0AEH1.pdb.gz	RSEP_ECOLI Regulator of sigma-E protease RseP OS=Escherichia coli (strain K12) OX=83333 GN=rseP PE=1 SV=1
10	AFDB:A0A024R2U5	0.367	0.191	2.422E-7	440	0.103	0.052	A0A024R2U5.pdb.gz
11	PDB:7w6xA	0.319	0.166	6.083E-6	447	0.126	0.063	7w6xA.pdb.gz	Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
12	PDB:3gdvA	0.291	0.223	5.436E-4	296	0.090	0.068	3gdvA.pdb.gz	OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
13	PDB:3pv2B	0.295	0.174	5.776E-4	388	0.085	0.049	3pv2B.pdb.gz
14	PDB:4jj0A	0.238	0.286	6.930E-4	181	0.063	0.077	4jj0A.pdb.gz	Structural insight into magnetochrome-mediated magnetite biomineralization.
15	PDB:5t69A	0.237	0.188	3.161E-3	284	0.067	0.053	5t69A.pdb.gz
16	PDB:1te0A	0.283	0.203	3.359E-3	318	0.081	0.057	1te0A.pdb.gz
17	PDB:1ky9B	0.263	0.156	6.165E-3	396	0.076	0.043	1ky9B.pdb.gz
18	PDB:4c2eA	0.215	0.118	1.442E-2	435	0.076	0.039	4c2eA.pdb.gz
19	PDB:7co5H	0.238	0.167	5.484E-2	325	0.067	0.046	7co5H.pdb.gz	Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
20	PDB:4a8cA	0.268	0.159	1.449E-1	395	0.076	0.043	4a8cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00233	4.16e-167	461	223	1.000	1.000	PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 PE=1 SV=3
2	Q9WTV5	5.69e-139	390	222	0.857	0.860	PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus OX=10116 GN=Psmd9 PE=1 SV=1
3	Q9VFS8	8.79e-50	163	220	0.395	0.400	PSMD9_DROME 26S proteasome non-ATPase regulatory subunit 9 OS=Drosophila melanogaster OX=7227 GN=CG9588 PE=1 SV=1
4	Q10920	1.13e-38	134	197	0.327	0.371	PSMD9_CAEEL Probable 26S proteasome non-ATPase regulatory subunit 9 OS=Caenorhabditis elegans OX=6239 GN=psmd-9 PE=1 SV=2
5	P40555	1.42e-35	127	220	0.327	0.332	PSMD9_YEAST Probable 26S proteasome regulatory subunit p27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAS2 PE=1 SV=1
6	O94393	1.74e-27	105	213	0.314	0.329	PSMD9_SCHPO Probable 26S proteasome regulatory subunit p27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nas2 PE=3 SV=1
7	Q57X08	3.15e-26	103	222	0.309	0.311	Q57X08_TRYB2 Proteasome 26S non-ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.470 PE=4 SV=1
8	Q8LAJ4	2.00e-24	98.6	227	0.269	0.264	Q8LAJ4_ARATH 26S proteasome regulatory subunit OS=Arabidopsis thaliana OX=3702 GN=MTI20.21 PE=1 SV=1
9	A0A1P8BA81	6.07e-24	97.8	256	0.269	0.234	A0A1P8BA81_ARATH 26S proteasome regulatory subunit OS=Arabidopsis thaliana OX=3702 GN=MTI20.21 PE=1 SV=1
10	Q9BQQ3	0.009	38.9	440	0.121	0.061	GORS1_HUMAN Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3
11	B4E1H8	0.012	38.5	345	0.117	0.075	B4E1H8_HUMAN Golgi reassembly stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=1
12	Q920G2	0.014	38.1	337	0.117	0.077	NHRF2_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Rattus norvegicus OX=10116 GN=Nherf2 PE=1 SV=1
13	B1WBR1	0.017	38.1	446	0.121	0.061	B1WBR1_RAT Golgi reassembly stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=1
14	Q91X51	0.017	38.1	446	0.130	0.065	GORS1_MOUSE Golgi reassembly-stacking protein 1 OS=Mus musculus OX=10090 GN=Gorasp1 PE=1 SV=3
15	O35254	0.021	37.7	451	0.130	0.064	GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=4
16	A0A0S2Z4V1	0.034	37.4	533	0.117	0.049	A0A0S2Z4V1_HUMAN Usher syndrome 1C (Autosomal recessive, severe), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=USH1C PE=2 SV=1
17	A0A8I5Y9F7	0.048	37.0	529	0.130	0.055	A0A8I5Y9F7_RAT USH1 protein network component harmonin OS=Rattus norvegicus OX=10116 GN=Ush1c PE=4 SV=1
18	Q9JHL1	0.072	36.2	337	0.117	0.077	NHRF2_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Mus musculus OX=10090 GN=Nherf2 PE=1 SV=2
19	A0A0S2Z4U9	0.12	35.4	552	0.112	0.045	A0A0S2Z4U9_HUMAN Usher syndrome 1C (Autosomal recessive, severe), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=USH1C PE=2 SV=1
20	Q9Y6N9	0.12	35.4	552	0.112	0.045	USH1C_HUMAN Harmonin OS=Homo sapiens OX=9606 GN=USH1C PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08224 DUF1719	6e+02	10.9	Domain of unknown function (DUF1719)
2	PF04495 GRASP55_65	0.71	21.6	GRASP55/65 PDZ-like domain
3	PF18265 Nas2_N	4.8e-31	117.8	Nas2 N_terminal domain
4	PF00595 PDZ	0.051	25.2	PDZ domain
5	PF13180 PDZ_2	8.2e-05	34.2	PDZ domain
6	PF17820 PDZ_6	1.9e-07	42.2	PDZ domain
7	PF02163 Peptidase_M50	0.0001	33.3	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401802	0.999	26S proteasome regulatory subunit 10B
2	9606.ENSP00000481029	0.999	26S proteasome regulatory subunit 6A
3	9606.ENSP00000157812	0.993	26S proteasome regulatory subunit 6B
4	9606.ENSP00000310572	0.992	26S proteasome regulatory subunit 8
5	9606.ENSP00000261712	0.990	26S proteasome non-ATPase regulatory subunit 11
6	9606.ENSP00000348442	0.990	26S proteasome non-ATPase regulatory subunit 12
7	9606.ENSP00000357879	0.986	26S proteasome non-ATPase regulatory subunit 4
8	9606.ENSP00000391211	0.986	26S proteasome regulatory subunit 7
9	9606.ENSP00000310129	0.984	26S proteasome non-ATPase regulatory subunit 2
10	9606.ENSP00000309474	0.983	26S proteasome non-ATPase regulatory subunit 1
11	9606.ENSP00000386541	0.981	26S proteasome non-ATPase regulatory subunit 14
12	9606.ENSP00000264639	0.979	26S proteasome non-ATPase regulatory subunit 3
13	9606.ENSP00000210313	0.978	26S proteasome non-ATPase regulatory subunit 5
14	9606.ENSP00000215071	0.978	26S proteasome non-ATPase regulatory subunit 8
15	9606.ENSP00000217958	0.974	26S proteasome non-ATPase regulatory subunit 10
16	9606.ENSP00000261303	0.974	26S proteasome regulatory subunit 4
17	9606.ENSP00000396937	0.974	Proteasome 26S subunit, non-ATPase 13
18	9606.ENSP00000216455	0.973	Proteasome subunit alpha type-3
19	9606.ENSP00000418695	0.973	Proteasome 26S subunit, non-ATPase 6
20	9606.ENSP00000262193	0.971	Proteasome subunit beta type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0022607	0.893	cellular component assembly
GO:0043933	0.888	protein-containing complex organization
GO:0050789	0.796	regulation of biological process
GO:0065003	0.719	protein-containing complex assembly
GO:0050794	0.619	regulation of cellular process
GO:0019222	0.525	regulation of metabolic process
GO:0060255	0.517	regulation of macromolecule metabolic process
GO:0080090	0.502	regulation of primary metabolic process
GO:0051171	0.494	regulation of nitrogen compound metabolic process
GO:0008152	0.383	metabolic process
GO:0048518	0.382	positive regulation of biological process
GO:0048519	0.367	negative regulation of biological process
GO:0048522	0.365	positive regulation of cellular process
GO:0048523	0.356	negative regulation of cellular process
GO:0050896	0.340	response to stimulus
GO:0031323	0.333	regulation of cellular metabolic process
GO:0009893	0.322	positive regulation of metabolic process
GO:0010604	0.304	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0005829	0.982	cytosol
GO:0140535	0.929	intracellular protein-containing complex
GO:1902494	0.917	catalytic complex
GO:0000502	0.892	proteasome complex
GO:0022624	0.545	proteasome accessory complex
GO:0005838	0.447	proteasome regulatory particle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]