StarFunc result for job id O00238

User Input

>input (502 residues)
MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVD
GPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPAS
RLTALRVKKTLAKMSESQDIKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R3J4	0.983	0.983	9.510E-97	502	0.982	0.982	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
2	AFDB:F1NTD3	0.740	0.740	3.437E-91	502	0.920	0.920	F1NTD3.pdb.gz	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
3	AFDB:Q9W629	0.749	0.713	6.372E-86	530	0.811	0.768	Q9W629.pdb.gz	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1
4	AFDB:A0A0R4I9Y4	0.840	0.790	1.242E-85	535	0.785	0.736	A0A0R4I9Y4.pdb.gz
5	AFDB:F1P3H0	0.653	0.616	2.664E-79	533	0.731	0.689	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
6	AFDB:O93243	0.658	0.627	1.934E-77	527	0.685	0.653	O93243.pdb.gz
7	AFDB:A0A0R4IZG7	0.673	0.632	9.708E-77	535	0.685	0.643	A0A0R4IZG7.pdb.gz
8	AFDB:P36897	0.726	0.724	6.104E-63	503	0.520	0.519	P36897.pdb.gz	TGFR1_HUMAN TGF-beta receptor type-1 OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
9	AFDB:Q9VMT1	0.626	0.548	1.126E-62	575	0.524	0.457	Q9VMT1.pdb.gz	Q9VMT1_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=2
10	AFDB:A1Z7L9	0.658	0.552	1.857E-62	601	0.478	0.399	A1Z7L9.pdb.gz	A1Z7L9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=babo PE=3 SV=1
11	PDB:1k9aB	0.434	0.491	1.647E-17	441	0.147	0.168	1k9aB.pdb.gz
12	PDB:8dksA	0.409	0.701	2.130E-16	283	0.141	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
13	PDB:4btfA	0.413	0.492	2.661E-16	413	0.125	0.153	4btfA.pdb.gz
14	PDB:1unlA	0.406	0.670	3.325E-16	292	0.145	0.250	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4krcA	0.423	0.693	4.391E-16	297	0.151	0.256	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4yc3A	0.411	0.672	7.660E-16	295	0.151	0.258	4yc3A.pdb.gz
17	PDB:6lk5A	0.432	0.778	1.131E-15	265	0.127	0.242	6lk5A.pdb.gz
18	PDB:2h8hA	0.408	0.457	1.579E-15	445	0.147	0.166	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:4eomC	0.413	0.720	2.754E-15	276	0.143	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:5u6yA	0.440	0.478	4.545E-15	459	0.127	0.139	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZJI2	1034	502	0.982	0.982	A0A8I5ZJI2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
2	A0A8I5ZXN2	1033	550	0.982	0.896	A0A8I5ZXN2_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
3	A0A8I6A0G0	1033	550	0.982	0.896	A0A8I6A0G0_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=1
4	B3DJG0	735	526	0.689	0.658	B3DJG0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr1a PE=2 SV=1
5	C0L3D6	843	535	0.811	0.761	C0L3D6_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=alk6b PE=2 SV=1
6	F1NTD3	946	502	0.920	0.920	F1NTD3_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1B PE=3 SV=1
7	F1P3H0	745	533	0.731	0.689	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
8	M0R3J4	937	491	0.890	0.910	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
9	O00238	1048	502	1.000	1.000	BMR1B_HUMAN Bone morphogenetic protein receptor type-1B OS=Homo sapiens OX=9606 GN=BMPR1B PE=1 SV=1
10	P36894	741	532	0.717	0.677	BMR1A_HUMAN Bone morphogenetic protein receptor type-1A OS=Homo sapiens OX=9606 GN=BMPR1A PE=1 SV=2
11	P36895	741	532	0.727	0.686	BMR1A_MOUSE Bone morphogenetic protein receptor type-1A OS=Mus musculus OX=10090 GN=Bmpr1a PE=1 SV=1
12	P36898	1037	502	0.982	0.982	BMR1B_MOUSE Bone morphogenetic protein receptor type-1B OS=Mus musculus OX=10090 GN=Bmpr1b PE=1 SV=1
13	Q05438	940	502	0.914	0.914	BMR1B_CHICK Bone morphogenetic protein receptor type-1B OS=Gallus gallus OX=9031 GN=BMPR1B PE=1 SV=1
14	Q1RLX1	735	527	0.689	0.657	Q1RLX1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:136731 PE=2 SV=1
15	Q569A5	620	297	0.586	0.990	Q569A5_RAT receptor protein serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=2 SV=1
16	Q66HY1	705	534	0.673	0.633	Q66HY1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:92227 PE=2 SV=1
17	Q78EA7	741	532	0.727	0.686	BMR1A_RAT Bone morphogenetic protein receptor type-1A OS=Rattus norvegicus OX=10116 GN=Bmpr1a PE=2 SV=1
18	Q90754	744	533	0.729	0.687	Q90754_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-1 PE=2 SV=1
19	Q95L23	1035	502	0.982	0.982	Q95L23_PIG receptor protein serine/threonine kinase OS=Sus scrofa OX=9823 GN=BMPR1B PE=2 SV=1
20	Q9W629	846	530	0.825	0.781	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	1.4e-10	53.3	Activin types I and II receptor domain
2	PF13095 FTA2	13	16.9	Kinetochore Sim4 complex subunit FTA2
3	PF12330 Haspin_kinase	2.2e+02	12.2	Haspin like kinase domain
4	PF00069 Pkinase	1.1e-32	125.1	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	4.6e-34	129.4	Protein tyrosine and serine/threonine kinase
6	PF08515 TGF_beta_GS	3e-12	57.2	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245451	0.999	Bone morphogenetic protein 4
2	9606.ENSP00000363492	0.999	Growth/differentiation factor 5
3	9606.ENSP00000368104	0.998	Bone morphogenetic protein 2
4	9606.ENSP00000379204	0.998	Bone morphogenetic protein 7
5	9606.ENSP00000283147	0.992	Bone morphogenetic protein 6
6	9606.ENSP00000288840	0.992	Mothers against decapentaplegic homolog 6
7	9606.ENSP00000252677	0.989	Bone morphogenetic protein 15
8	9606.ENSP00000441954	0.979	Mothers against decapentaplegic homolog 5
9	9606.ENSP00000262158	0.977	Mothers against decapentaplegic homolog 7
10	9606.ENSP00000369154	0.977	Mothers against decapentaplegic homolog 9
11	9606.ENSP00000452126	0.973	Repulsive guidance molecule A
12	9606.ENSP00000354621	0.971	E3 ubiquitin-protein ligase SMURF1
13	9606.ENSP00000328181	0.970	Noggin
14	9606.ENSP00000364683	0.970	BMP and activin membrane-bound inhibitor homolog
15	9606.ENSP00000426568	0.969	Mothers against decapentaplegic homolog 1
16	9606.ENSP00000204604	0.967	Chordin
17	9606.ENSP00000363708	0.960	Bone morphogenetic protein receptor type-2
18	9606.ENSP00000287020	0.959	Growth/differentiation factor 6
19	9606.ENSP00000341551	0.956	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000308219	0.953	RGM domain family member B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004674	0.998	protein serine/threonine kinase activity
GO:0097159	0.913	organic cyclic compound binding
GO:1901363	0.912	heterocyclic compound binding
GO:0019199	0.804	transmembrane receptor protein kinase activity
GO:0043167	0.654	ion binding
GO:0004675	0.602	transmembrane receptor protein serine/threonine kinase activity
GO:0036094	0.553	small molecule binding
GO:0043168	0.527	anion binding
GO:0000166	0.527	nucleotide binding
GO:0032559	0.524	adenyl ribonucleotide binding
GO:0005524	0.488	ATP binding
GO:0044877	0.383	protein-containing complex binding
GO:0005102	0.355	signaling receptor binding
GO:0019955	0.323	cytokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0032501	0.985	multicellular organismal process
GO:0007178	0.981	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048856	0.978	anatomical structure development
GO:0071363	0.977	cellular response to growth factor stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0048513	0.960	animal organ development
GO:0010468	0.958	regulation of gene expression
GO:0048731	0.957	system development
GO:0010556	0.925	regulation of macromolecule biosynthetic process
GO:0010604	0.924	positive regulation of macromolecule metabolic process
GO:0030501	0.920	positive regulation of bone mineralization
GO:0001501	0.919	skeletal system development
GO:0071772	0.915	response to BMP
GO:0031326	0.911	regulation of cellular biosynthetic process
GO:0019219	0.905	regulation of nucleobase-containing compound metabolic process
GO:0071773	0.900	cellular response to BMP stimulus
GO:0051252	0.897	regulation of RNA metabolic process
GO:0030509	0.890	BMP signaling pathway
GO:0009653	0.886	anatomical structure morphogenesis
GO:0030154	0.871	cell differentiation
GO:0051173	0.870	positive regulation of nitrogen compound metabolic process
GO:0031325	0.860	positive regulation of cellular metabolic process
GO:2001141	0.853	regulation of RNA biosynthetic process
GO:0048523	0.847	negative regulation of cellular process
GO:0045595	0.843	regulation of cell differentiation
GO:0071704	0.839	organic substance metabolic process
GO:0010557	0.831	positive regulation of macromolecule biosynthetic process
GO:0061035	0.817	regulation of cartilage development
GO:0031328	0.815	positive regulation of cellular biosynthetic process
GO:0002062	0.814	chondrocyte differentiation
GO:0001503	0.806	ossification
GO:0061036	0.790	positive regulation of cartilage development
GO:0044238	0.782	primary metabolic process
GO:0045597	0.779	positive regulation of cell differentiation
GO:0044237	0.750	cellular metabolic process
GO:0043170	0.732	macromolecule metabolic process
GO:0042127	0.732	regulation of cell population proliferation
GO:0006355	0.731	regulation of DNA-templated transcription
GO:0006807	0.721	nitrogen compound metabolic process
GO:0060348	0.715	bone development
GO:1901135	0.706	carbohydrate derivative metabolic process
GO:0045893	0.656	positive regulation of DNA-templated transcription
GO:0010941	0.650	regulation of cell death
GO:1901564	0.630	organonitrogen compound metabolic process
GO:0048583	0.626	regulation of response to stimulus
GO:0019538	0.605	protein metabolic process
GO:0023051	0.575	regulation of signaling
GO:0010646	0.575	regulation of cell communication
GO:0006357	0.506	regulation of transcription by RNA polymerase II
GO:0009966	0.503	regulation of signal transduction
GO:0009887	0.475	animal organ morphogenesis
GO:0048468	0.418	cell development
GO:0008284	0.361	positive regulation of cell population proliferation
GO:0048584	0.345	positive regulation of response to stimulus
GO:0045667	0.338	regulation of osteoblast differentiation
GO:0023056	0.319	positive regulation of signaling
GO:0010647	0.319	positive regulation of cell communication
GO:0090092	0.319	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048705	0.307	skeletal system morphogenesis
GO:0060349	0.300	bone morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.982	plasma membrane
GO:0005622	0.758	intracellular anatomical structure
GO:0005737	0.625	cytoplasm
GO:0043226	0.478	organelle
GO:0043229	0.449	intracellular organelle
GO:0032991	0.443	protein-containing complex
GO:0042995	0.351	cell projection
GO:0120025	0.315	plasma membrane bounded cell projection
GO:0036477	0.300	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.
RHEA:18673	0.602	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.602	receptor protein serine/threonine kinase.

[back to server]