StarFunc result for job id O00255

User Input

>input (615 residues)
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHL
ALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKME
VAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGR
PDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCR
EDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLR
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEA
REGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTA
QVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTP
SDYTLSFLKRQRKGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00255	1.000	1.000	3.242E-91	615	1.000	1.000	O00255.pdb.gz	MEN1_HUMAN Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=5
2	AFDB:E7EN32	0.732	0.810	2.390E-70	555	0.898	0.995	E7EN32.pdb.gz	E7EN32_HUMAN Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=1
3	AFDB:Q503J8	0.814	0.811	3.761E-66	617	0.665	0.663	Q503J8.pdb.gz
4	AFDB:Q9VM47	0.724	0.586	7.138E-41	763	0.415	0.334	Q9VM47.pdb.gz	Q9VM47_DROME Menin OS=Drosophila melanogaster OX=7227 GN=Mnn1 PE=4 SV=3
5	AFDB:A0A024R0F8	0.159	0.145	3.951E-2	684	0.078	0.070	A0A024R0F8.pdb.gz
6	AFDB:Q9XZ34	0.129	0.085	5.651E-2	1416	0.124	0.054	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
7	AFDB:O75170	0.121	0.090	7.391E-2	966	0.060	0.038	O75170.pdb.gz	PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2
8	PDB:7ntfA	0.122	0.088	9.598E-2	918	0.057	0.038	7ntfA.pdb.gz
9	PDB:5g05F	0.144	0.174	1.373E-1	460	0.068	0.091	5g05F.pdb.gz	Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
10	PDB:7r5jB0	0.202	0.090	1.373E-1	1748	0.088	0.031	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
11	PDB:4bujB	0.167	0.093	1.501E-1	1367	0.075	0.034	4bujB.pdb.gz
12	AFDB:B5X0I6	0.191	0.123	1.891E-1	1091	0.101	0.057	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
13	PDB:1qteA	0.078	0.078	2.054E-1	618	0.083	0.083	1qteA.pdb.gz
14	PDB:7dkhI	0.125	0.093	2.349E-1	914	0.060	0.040	7dkhI.pdb.gz
15	PDB:7pntV	0.136	0.194	2.349E-1	365	0.047	0.079	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	AFDB:Q8L7A9	0.114	0.085	2.473E-1	938	0.119	0.078	Q8L7A9.pdb.gz	AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=At1g31730 PE=1 SV=1
17	PDB:7po24	0.122	0.125	2.937E-1	592	0.093	0.096	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:7qdrB	0.163	0.097	3.212E-1	1212	0.085	0.043	7qdrB.pdb.gz
19	PDB:4m57A	0.100	0.093	3.513E-1	702	0.112	0.098	4m57A.pdb.gz
20	AFDB:A2AF47	0.121	0.065	3.700E-1	2073	0.102	0.030	A2AF47.pdb.gz	DOC11_MOUSE Dedicator of cytokinesis protein 11 OS=Mus musculus OX=10090 GN=Dock11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EN32	0.0	949	555	0.810	0.897	E7EN32_HUMAN Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=1
2	O00255	0.0	1264	615	1.000	1.000	MEN1_HUMAN Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=5
3	O88559	0.0	1061	611	0.958	0.964	MEN1_MOUSE Menin OS=Mus musculus OX=10090 GN=Men1 PE=1 SV=2
4	Q9IAA9	0.0	740	617	0.662	0.660	Q9IAA9_DANRE Menin OS=Danio rerio OX=7955 GN=zgc:110510 PE=1 SV=1
5	Q9WVR8	0.0	1208	610	0.961	0.969	MEN1_RAT Menin OS=Rattus norvegicus OX=10116 GN=Men1 PE=1 SV=1
6	Q8SXU2	1.19e-123	377	530	0.367	0.426	Q8SXU2_DROME Menin OS=Drosophila melanogaster OX=7227 GN=Mnn1 PE=2 SV=1
7	Q9VM47	3.81e-122	381	763	0.367	0.296	Q9VM47_DROME Menin OS=Drosophila melanogaster OX=7227 GN=Mnn1 PE=4 SV=3
8	Q7KXY9	4.86e-122	380	751	0.367	0.301	Q7KXY9_DROME Menin OS=Drosophila melanogaster OX=7227 GN=Mnn1 PE=2 SV=1
9	O00139	0.20	37.4	706	0.068	0.059	KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A PE=1 SV=3
10	P28740	0.20	37.4	705	0.068	0.060	KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus OX=10090 GN=Kif2a PE=1 SV=2
11	Q8GZU0	0.44	35.8	443	0.057	0.079	MAT_CATRO Minovincinine 19-hydroxy-O-acetyltransferase OS=Catharanthus roseus OX=4058 GN=MAT PE=1 SV=1
12	Q9WV63	0.93	35.0	705	0.068	0.060	KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus OX=10116 GN=Kif2a PE=1 SV=2
13	O60346	3.5	33.5	1717	0.034	0.012	PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3
14	Q640L3	8.1	32.0	753	0.076	0.062	CCPG1_MOUSE Cell cycle progression protein 1 OS=Mus musculus OX=10090 GN=Ccpg1 PE=1 SV=2
15	P47103	9.6	31.6	393	0.039	0.061	CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPR7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05053 Menin	6e-272	915.7	Menin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337088

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436786	0.999	Histone-lysine N-methyltransferase 2A
2	9606.ENSP00000252818	0.998	Transcription factor jun-D
3	9606.ENSP00000301067	0.996	Histone-lysine N-methyltransferase 2D
4	9606.ENSP00000332973	0.996	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000370109	0.996	PC4 and SFRS1-interacting protein
6	9606.ENSP00000398837	0.996	Histone-lysine N-methyltransferase 2B
7	9606.ENSP00000351446	0.995	WD repeat-containing protein 5
8	9606.ENSP00000340896	0.991	Set1/Ash2 histone methyltransferase complex subunit ASH2
9	9606.ENSP00000264515	0.986	Retinoblastoma-binding protein 5
10	9606.ENSP00000405330	0.979	Estrogen receptor
11	9606.ENSP00000344456	0.972	Catenin beta-1
12	9606.ENSP00000362649	0.972	Histone deacetylase 1
13	9606.ENSP00000262519	0.957	Histone-lysine N-methyltransferase SETD1A
14	9606.ENSP00000212015	0.936	NAD-dependent protein deacetylase sirtuin-1
15	9606.ENSP00000355657	0.933	Histone H3.1t
16	9606.ENSP00000287647	0.919	Fanconi anemia group D2 protein
17	9606.ENSP00000332194	0.914	Histone H2A type 2-C
18	9606.ENSP00000358151	0.913	Histone H2B type 2-E
19	9606.ENSP00000296417	0.910	Histone H2A.Z
20	9606.ENSP00000320147	0.909	Histone-lysine N-methyltransferase EZH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0043565	0.935	sequence-specific DNA binding
GO:0003690	0.889	double-stranded DNA binding
GO:0001067	0.877	transcription regulatory region nucleic acid binding
GO:0000976	0.870	transcription cis-regulatory region binding
GO:0060090	0.545	molecular adaptor activity
GO:0046332	0.544	SMAD binding
GO:0000400	0.538	four-way junction DNA binding
GO:0070412	0.519	R-SMAD binding
GO:0030674	0.485	protein-macromolecule adaptor activity
GO:0000403	0.344	Y-form DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0080090	0.993	regulation of primary metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0009987	0.991	cellular process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0042127	0.982	regulation of cell population proliferation
GO:0048518	0.977	positive regulation of biological process
GO:0045892	0.976	negative regulation of DNA-templated transcription
GO:0050896	0.961	response to stimulus
GO:0048522	0.942	positive regulation of cellular process
GO:0008285	0.936	negative regulation of cell population proliferation
GO:0008152	0.932	metabolic process
GO:0032502	0.919	developmental process
GO:0010604	0.916	positive regulation of macromolecule metabolic process
GO:0031325	0.916	positive regulation of cellular metabolic process
GO:0044238	0.912	primary metabolic process
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:0032501	0.904	multicellular organismal process
GO:0006357	0.888	regulation of transcription by RNA polymerase II
GO:0045935	0.885	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.878	positive regulation of RNA metabolic process
GO:0031328	0.869	positive regulation of cellular biosynthetic process
GO:0045893	0.863	positive regulation of DNA-templated transcription
GO:0048856	0.853	anatomical structure development
GO:0051716	0.808	cellular response to stimulus
GO:0071704	0.806	organic substance metabolic process
GO:0048583	0.791	regulation of response to stimulus
GO:0050680	0.789	negative regulation of epithelial cell proliferation
GO:0023051	0.783	regulation of signaling
GO:0010646	0.783	regulation of cell communication
GO:0065009	0.774	regulation of molecular function
GO:0044237	0.770	cellular metabolic process
GO:0051726	0.755	regulation of cell cycle
GO:0051246	0.750	regulation of protein metabolic process
GO:0006807	0.727	nitrogen compound metabolic process
GO:0009966	0.722	regulation of signal transduction
GO:0000122	0.697	negative regulation of transcription by RNA polymerase II
GO:0043170	0.694	macromolecule metabolic process
GO:0051174	0.678	regulation of phosphorus metabolic process
GO:0023052	0.655	signaling
GO:0031399	0.654	regulation of protein modification process
GO:0007165	0.650	signal transduction
GO:0050790	0.601	regulation of catalytic activity
GO:0019220	0.600	regulation of phosphate metabolic process
GO:0045944	0.595	positive regulation of transcription by RNA polymerase II
GO:0006950	0.514	response to stress
GO:0044092	0.507	negative regulation of molecular function
GO:0042325	0.486	regulation of phosphorylation
GO:0051338	0.485	regulation of transferase activity
GO:0071840	0.425	cellular component organization or biogenesis
GO:0050793	0.425	regulation of developmental process
GO:0045595	0.406	regulation of cell differentiation
GO:0001932	0.404	regulation of protein phosphorylation
GO:0045859	0.389	regulation of protein kinase activity
GO:0048585	0.385	negative regulation of response to stimulus
GO:0016043	0.380	cellular component organization
GO:0009968	0.372	negative regulation of signal transduction
GO:0035556	0.370	intracellular signal transduction
GO:1902531	0.364	regulation of intracellular signal transduction
GO:0030154	0.346	cell differentiation
GO:0010564	0.344	regulation of cell cycle process
GO:0051248	0.325	negative regulation of protein metabolic process
GO:0036211	0.322	protein modification process
GO:0045936	0.314	negative regulation of phosphate metabolic process
GO:0045667	0.303	regulation of osteoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.987	cytosol
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0032991	0.926	protein-containing complex
GO:0005694	0.829	chromosome
GO:0140513	0.517	nuclear protein-containing complex
GO:0016020	0.315	membrane
GO:1902494	0.302	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]