StarFunc result for job id O00258

User Input

>input (174 residues)
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQEL
STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLI
WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00258	1.000	1.000	7.430E-25	174	1.000	1.000	O00258.pdb.gz	GET1_HUMAN Guided entry of tail-anchored proteins factor 1 OS=Homo sapiens OX=9606 GN=GET1 PE=1 SV=2
2	AFDB:Q6DRM0	0.789	0.805	1.005E-17	170	0.678	0.694	Q6DRM0.pdb.gz	GET1_DANRE Guided entry of tail-anchored proteins factor 1 OS=Danio rerio OX=7955 GN=get1 PE=2 SV=1
3	PDB:6so5C	0.626	0.731	5.045E-14	144	0.822	0.993	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
4	AFDB:Q8T481	0.591	0.582	1.973E-5	178	0.184	0.180	Q8T481.pdb.gz	Q8T481_DROME AT11343p OS=Drosophila melanogaster OX=7227 GN=Wrb PE=1 SV=1
5	AFDB:Q9HGM2	0.575	0.582	1.312E-4	171	0.178	0.181	Q9HGM2.pdb.gz	GET1_SCHPO Protein get1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=get1 PE=1 SV=1
6	AFDB:Q1H5D2	0.703	0.690	1.651E-4	178	0.178	0.174	Q1H5D2.pdb.gz	GET1_ARATH Protein GET1 OS=Arabidopsis thaliana OX=3702 GN=GET1 PE=1 SV=1
7	AFDB:P53192	0.368	0.298	3.086E-3	235	0.224	0.166	P53192.pdb.gz	GET1_YEAST Golgi to ER traffic protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GET1 PE=1 SV=1
8	AFDB:Q9UM00	0.313	0.242	1.938E-2	239	0.149	0.109	Q9UM00.pdb.gz	TMCO1_HUMAN Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2
9	PDB:4ke2A	0.470	0.426	6.585E-1	196	0.132	0.117	4ke2A.pdb.gz
10	AFDB:Q54S78	0.391	0.059	9.614E-1	1671	0.132	0.014	Q54S78.pdb.gz	Q54S78_DICDI Phosphatidylinositol 3-kinase OS=Dictyostelium discoideum OX=44689 GN=pikG PE=3 SV=1
11	AFDB:Q96MC5	0.290	0.253	9.614E-1	204	0.138	0.118	Q96MC5.pdb.gz	MERB1_HUMAN bMERB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BMERB1 PE=1 SV=1
12	AFDB:Q9H4M7	0.283	0.105	1.210	779	0.126	0.028	Q9H4M7.pdb.gz	PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2
13	PDB:1u2mC	0.468	0.555	1.471	143	0.057	0.070	1u2mC.pdb.gz
14	PDB:7vwcA	0.334	0.130	1.748	617	0.109	0.031	7vwcA.pdb.gz
15	PDB:6wczA	0.273	0.166	1.851	350	0.144	0.071	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
16	PDB:7rraA	0.261	0.102	2.076	602	0.155	0.045	7rraA.pdb.gz
17	PDB:6tejB	0.351	0.148	2.466	585	0.144	0.043	6tejB.pdb.gz	The ABC exporter IrtAB imports and reduces mycobacterial siderophores.
18	PDB:7ph3A	0.381	0.157	2.766	577	0.098	0.029	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
19	PDB:6v4uB	0.244	0.129	2.930	421	0.098	0.040	6v4uB.pdb.gz
20	PDB:7msct	0.286	0.547	3.286	85	0.063	0.129	7msct.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00258	1.09e-127	357	174	1.000	1.000	GET1_HUMAN Guided entry of tail-anchored proteins factor 1 OS=Homo sapiens OX=9606 GN=GET1 PE=1 SV=2
2	Q8K0D7	4.46e-120	338	174	0.931	0.931	GET1_MOUSE Guided entry of tail-anchored proteins factor 1 OS=Mus musculus OX=10090 GN=Get1 PE=1 SV=1
3	Q6P6S5	3.79e-119	335	174	0.920	0.920	GET1_RAT Guided entry of tail-anchored proteins factor 1 OS=Rattus norvegicus OX=10116 GN=Get1 PE=1 SV=1
4	Q6DRM0	1.79e-87	255	170	0.678	0.694	GET1_DANRE Guided entry of tail-anchored proteins factor 1 OS=Danio rerio OX=7955 GN=get1 PE=2 SV=1
5	Q8T481	1.71e-06	48.1	178	0.195	0.191	Q8T481_DROME AT11343p OS=Drosophila melanogaster OX=7227 GN=Wrb PE=1 SV=1
6	Q9HGM2	4.59e-06	46.6	171	0.167	0.170	GET1_SCHPO Protein get1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=get1 PE=1 SV=1
7	Q1H5D2	2.97e-04	41.6	178	0.161	0.157	GET1_ARATH Protein GET1 OS=Arabidopsis thaliana OX=3702 GN=GET1 PE=1 SV=1
8	P19121	0.082	35.4	615	0.126	0.036	ALBU_CHICK Albumin OS=Gallus gallus OX=9031 GN=ALB PE=1 SV=2
9	Q3UKC1	0.31	33.5	814	0.103	0.022	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
10	P55937	0.65	32.7	1487	0.126	0.015	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
11	Q86VP1	0.96	32.3	789	0.086	0.019	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
12	Q13972	1.1	32.0	1273	0.115	0.016	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
13	Q66HA4	1.4	31.6	813	0.080	0.017	TAXB1_RAT Tax1-binding protein 1 homolog OS=Rattus norvegicus OX=10116 GN=Tax1bp1 PE=2 SV=1
14	O00899	1.9	31.2	860	0.098	0.020	GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum OX=44689 GN=gapA PE=1 SV=1
15	H3BP78	2.4	31.2	1090	0.126	0.020	H3BP78_HUMAN FA complementation group I (Fragment) OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=1
16	O75069	2.4	30.8	709	0.103	0.025	TMCC2_HUMAN Transmembrane and coiled-coil domains protein 2 OS=Homo sapiens OX=9606 GN=TMCC2 PE=1 SV=3
17	Q20641	2.4	31.2	1963	0.098	0.009	Q20641_CAEEL Myosin-11 OS=Caenorhabditis elegans OX=6239 GN=nmy-1 PE=1 SV=2
18	A8IQE0	2.5	30.8	894	0.115	0.022	CCD39_CHLRE Coiled-coil domain-containing protein 39 OS=Chlamydomonas reinhardtii OX=3055 GN=CCDC39 PE=1 SV=1
19	Q0PBM2	2.6	30.8	769	0.132	0.030	Q0PBM2_CAMJE histidine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=cheA PE=1 SV=1
20	Q9R0W9	3.2	30.4	494	0.092	0.032	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04420 CHD5	5.7e-31	119.0	CHD5-like protein
2	PF06295 DUF1043	19	16.6	Protein of unknown function (DUF1043)
3	PF09969 DUF2203	1.4	21.1	Uncharacterized conserved protein (DUF2203)
4	PF16013 DUF4781	92	13.3	Domain of unknown function (DUF4781)
5	PF19903 DUF6376	66	15.2	Family of unknown function (DUF6376)
6	PF20379 DUF6674	2.4e+02	12.7	Family of unknown function (DUF6674)
7	PF12018 FAP206	1.8e+02	12.9	Domain of unknown function
8	PF04678 MCU	5.9e+02	11.9	Mitochondrial calcium uniporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015940

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012716	0.995	Arsenical pump-driving ATPase
2	61853.ENSNLEP00000009949	0.962	Calcium signal-modulating cyclophilin ligand
3	61853.ENSNLEP00000010249	0.792	Golgi to ER traffic protein 4 homolog (S. cerevisiae)
4	61853.ENSNLEP00000001328	0.751	Trimethylguanosine synthase 1
5	61853.ENSNLEP00000017353	0.751	Ubiquitin-like 4A
6	61853.ENSNLEP00000002934	0.725	Small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
7	61853.ENSNLEP00000020712	0.712	Protein transport protein Sec61 subunit beta
8	61853.ENSNLEP00000003889	0.639	Stress-associated endoplasmic reticulum protein
9	61853.ENSNLEP00000004363	0.632	Small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
10	61853.ENSNLEP00000005401	0.632	Transmembrane protein 208
11	61853.ENSNLEP00000005310	0.629	ER membrane protein complex subunit 3
12	61853.ENSNLEP00000005123	0.587	Syntaxin 5
13	61853.ENSNLEP00000015916	0.569	Proteasome (prosome, macropain) assembly chaperone 1
14	61853.ENSNLEP00000019979	0.563	Tetratricopeptide repeat domain 33
15	61853.ENSNLEP00000005159	0.525	Small integral membrane protein 11
16	61853.ENSNLEP00000017926	0.525	Calcium load-activated calcium channel
17	61853.ENSNLEP00000004596	0.522	PAX3 and PAX7 binding protein 1
18	61853.ENSNLEP00000007502	0.522	BCL2-associated athanogene 6
19	61853.ENSNLEP00000016480	0.522	Uncharacterized protein
20	61853.ENSNLEP00000002945	0.520	Otoferlin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0010256	0.993	endomembrane system organization
GO:0033365	0.990	protein localization to organelle
GO:0090150	0.989	establishment of protein localization to membrane
GO:0007029	0.970	endoplasmic reticulum organization
GO:0045048	0.959	protein insertion into ER membrane
GO:0065007	0.779	biological regulation
GO:0006810	0.369	transport
GO:0071816	0.340	tail-anchored membrane protein insertion into ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0032991	0.999	protein-containing complex
GO:0005634	0.975	nucleus
GO:0016020	0.962	membrane
GO:0140534	0.920	endoplasmic reticulum protein-containing complex
GO:0031090	0.799	organelle membrane
GO:0031984	0.674	organelle subcompartment
GO:0098827	0.635	endoplasmic reticulum subcompartment
GO:0043529	0.518	GET complex
GO:0005829	0.468	cytosol
GO:0005789	0.347	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]