StarFunc result for job id O00264

User Input

>input (195 residues)
MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVY
SDEEEPKDESARKND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E5M5	0.846	0.725	3.252E-32	230	0.913	0.774	G5E5M5.pdb.gz	G5E5M5_BOVIN Progesterone receptor membrane component 1 OS=Bos taurus OX=9913 GN=PGRMC1 PE=4 SV=2
2	AFDB:Q5U3G0	0.770	0.835	3.394E-26	179	0.605	0.659	Q5U3G0.pdb.gz	Q5U3G0_DANRE Membrane-associated progesterone receptor component 1 OS=Danio rerio OX=7955 GN=fa94d03 PE=1 SV=1
3	AFDB:Q80UU9	0.719	0.650	1.067E-22	217	0.538	0.484	Q80UU9.pdb.gz	PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus OX=10090 GN=Pgrmc2 PE=1 SV=2
4	AFDB:O15173	0.685	0.605	3.717E-22	223	0.528	0.462	O15173.pdb.gz	PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1
5	AFDB:Q7SZC7	0.648	0.629	7.387E-22	201	0.518	0.502	Q7SZC7.pdb.gz	Q7SZC7_DANRE Membrane-associated progesterone receptor component 2 OS=Danio rerio OX=7955 GN=wu:fb25g12 PE=1 SV=1
6	AFDB:Q9VXM4	0.719	0.575	1.235E-19	248	0.518	0.407	Q9VXM4.pdb.gz	Q9VXM4_DROME LD12946p OS=Drosophila melanogaster OX=7227 GN=MSBP PE=1 SV=1
7	AFDB:Q4WXS1	0.554	0.688	1.619E-16	155	0.354	0.445	Q4WXS1.pdb.gz	Q4WXS1_ASPFU DNA damage response protein (Dap1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G10490 PE=4 SV=1
8	AFDB:Q7YZW5	0.584	0.621	9.897E-16	183	0.318	0.339	Q7YZW5.pdb.gz	VEM1_CAEEL Protein vem-1 OS=Caenorhabditis elegans OX=6239 GN=vem-1 PE=1 SV=1
9	AFDB:O13995	0.540	0.630	4.428E-15	166	0.292	0.343	O13995.pdb.gz	DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dap1 PE=1 SV=1
10	AFDB:Q6FUH0	0.533	0.676	4.428E-15	152	0.308	0.395	Q6FUH0.pdb.gz	Q6FUH0_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=DAP1 PE=4 SV=1
11	PDB:1t0gA	0.464	0.798	2.879E-9	109	0.205	0.367	1t0gA.pdb.gz
12	PDB:4rerA	0.144	0.077	2.885	459	0.087	0.037	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
13	PDB:7kzmE	0.131	0.072	3.268	474	0.072	0.030	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
14	PDB:1aroL	0.130	0.167	4.195	149	0.036	0.047	1aroL.pdb.gz
15	PDB:7z0sF	0.093	0.108	5.732	164	0.046	0.055	7z0sF.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
16	PDB:4fi3C	0.138	0.111	6.101	248	0.031	0.024	4fi3C.pdb.gz	Structure of AMP-PNP-bound vitamin B12 transporter BtuCD-F.
17	PDB:6mrjB	0.124	0.161	6.101	142	0.036	0.049	6mrjB.pdb.gz	Crystal structure of H.pylori NikR in complex with DNA
18	PDB:6b1uA	0.114	0.060	7.358	442	0.067	0.029	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
19	PDB:7cccB	0.108	0.071	7.358	342	0.051	0.029	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
20	PDB:1a4vA	0.112	0.139	9.445	123	0.051	0.081	1a4vA.pdb.gz	Structural evidence for the presence of a secondary calcium binding site in human alpha-lactalbumin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00264	3.60e-142	395	195	1.000	1.000	PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3
2	Q6IB11	3.60e-142	395	195	1.000	1.000	Q6IB11_HUMAN PGRMC1 protein OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=1
3	O55022	4.20e-124	350	195	0.954	0.954	PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus OX=10090 GN=Pgrmc1 PE=1 SV=4
4	G5E5M5	1.81e-121	344	230	0.954	0.809	G5E5M5_BOVIN Progesterone receptor membrane component 1 OS=Bos taurus OX=9913 GN=PGRMC1 PE=4 SV=2
5	Q17QC0	1.67e-120	340	194	0.949	0.954	PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus OX=9913 GN=PGRMC1 PE=2 SV=3
6	P70580	9.81e-112	318	195	0.933	0.933	PGRC1_RAT Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus OX=10116 GN=Pgrmc1 PE=1 SV=3
7	Q5U3G0	2.55e-79	236	179	0.615	0.670	Q5U3G0_DANRE Membrane-associated progesterone receptor component 1 OS=Danio rerio OX=7955 GN=fa94d03 PE=1 SV=1
8	Q80UU9	4.01e-65	201	217	0.513	0.461	PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus OX=10090 GN=Pgrmc2 PE=1 SV=2
9	O15173	3.68e-63	196	223	0.492	0.430	PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1
10	Q7SZC7	1.84e-61	191	201	0.451	0.438	Q7SZC7_DANRE Membrane-associated progesterone receptor component 2 OS=Danio rerio OX=7955 GN=wu:fb25g12 PE=1 SV=1
11	Q9VXM4	1.71e-58	185	248	0.497	0.391	Q9VXM4_DROME LD12946p OS=Drosophila melanogaster OX=7227 GN=MSBP PE=1 SV=1
12	Q7YZW5	2.57e-34	122	183	0.318	0.339	VEM1_CAEEL Protein vem-1 OS=Caenorhabditis elegans OX=6239 GN=vem-1 PE=1 SV=1
13	Q4WXS1	5.60e-34	120	155	0.379	0.477	Q4WXS1_ASPFU DNA damage response protein (Dap1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G10490 PE=4 SV=1
14	O13995	3.12e-30	110	166	0.313	0.367	DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dap1 PE=1 SV=1
15	Q6FUH0	2.02e-27	103	152	0.292	0.375	Q6FUH0_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=DAP1 PE=4 SV=1
16	Q12091	1.11e-25	98.6	152	0.277	0.355	DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAP1 PE=1 SV=1
17	Q9M2Z4	3.49e-24	97.1	233	0.318	0.266	MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=MSBP2 PE=1 SV=1
18	Q9XFM6	3.91e-24	96.7	220	0.308	0.273	MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MSBP1 PE=1 SV=2
19	Q9SK39	1.36e-19	81.6	100	0.215	0.420	SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MP3 PE=1 SV=1
20	Q8WUJ1	5.00e-16	75.9	264	0.231	0.170	NEUFC_HUMAN Neuferricin OS=Homo sapiens OX=9606 GN=CYB5D2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00173 Cyt-b5	7e-12	56.6	Cytochrome b5-like Heme/Steroid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217971

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360034	0.986	Plasminogen activator inhibitor 1 RNA-binding protein
2	9606.ENSP00000344741	0.977	Insulin-induced gene 1 protein
3	9606.ENSP00000275493	0.968	Epidermal growth factor receptor
4	9606.ENSP00000003100	0.956	Lanosterol 14-alpha demethylase
5	9606.ENSP00000362353	0.949	Glucagon-like peptide 1 receptor
6	9606.ENSP00000301645	0.946	Cholesterol 7-alpha-monooxygenase
7	9606.ENSP00000342007	0.902	Cytochrome P450 1A2
8	9606.ENSP00000372326	0.888	Ferrochelatase, mitochondrial
9	9606.ENSP00000325120	0.843	Progesterone receptor
10	9606.ENSP00000341625	0.816	Cytochrome b5
11	9606.ENSP00000363414	0.786	Membrane progestin receptor alpha
12	9606.ENSP00000406197	0.716	Membrane progestin receptor beta
13	9606.ENSP00000378803	0.714	Membrane progestin receptor gamma
14	9606.ENSP00000289359	0.694	MIT domain-containing protein 1
15	9606.ENSP00000445905	0.690	EVI5-like protein
16	9606.ENSP00000341564	0.680	Membrane progestin receptor epsilon
17	9606.ENSP00000338330	0.679	Membrane progestin receptor delta
18	9606.ENSP00000324270	0.677	Oxytocin receptor
19	9606.ENSP00000255120	0.676	Nuclear autoantigenic sperm protein
20	9606.ENSP00000348455	0.667	UV radiation resistance-associated gene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0020037	0.999	heme binding
GO:0005496	0.387	steroid binding
GO:0003824	0.328	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0032502	0.873	developmental process
GO:0065007	0.869	biological regulation
GO:0032501	0.858	multicellular organismal process
GO:0048856	0.843	anatomical structure development
GO:0008152	0.816	metabolic process
GO:0071704	0.798	organic substance metabolic process
GO:0048869	0.744	cellular developmental process
GO:0050789	0.728	regulation of biological process
GO:0050794	0.720	regulation of cellular process
GO:0030154	0.673	cell differentiation
GO:0048468	0.655	cell development
GO:0044237	0.556	cellular metabolic process
GO:0006807	0.549	nitrogen compound metabolic process
GO:0044238	0.520	primary metabolic process
GO:0009994	0.516	oocyte differentiation
GO:0050896	0.506	response to stimulus
GO:0007049	0.473	cell cycle
GO:1901564	0.473	organonitrogen compound metabolic process
GO:0021700	0.425	developmental maturation
GO:0048518	0.380	positive regulation of biological process
GO:0048469	0.350	cell maturation
GO:0048599	0.348	oocyte development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0031090	0.980	organelle membrane
GO:0005634	0.975	nucleus
GO:0071944	0.928	cell periphery
GO:0031982	0.916	vesicle
GO:0005886	0.796	plasma membrane
GO:0005783	0.758	endoplasmic reticulum
GO:0043232	0.685	intracellular non-membrane-bounded organelle
GO:0070013	0.590	intracellular organelle lumen
GO:0031981	0.482	nuclear lumen
GO:0031967	0.458	organelle envelope
GO:0005739	0.446	mitochondrion
GO:0032991	0.427	protein-containing complex
GO:0098588	0.420	bounding membrane of organelle
GO:0005654	0.397	nucleoplasm
GO:0031410	0.383	cytoplasmic vesicle
GO:0005856	0.364	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]