StarFunc result for job id O00267

User Input

>input (1087 residues)
MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEE
EDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRS
GARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLW
TVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIE
GVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQ
NTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLI
FEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKV
IAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELV
QLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIV
KVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVG
GFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGY
IGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGS
GSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
SYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSP
GGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSE
KVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRF
LGKLLEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00267	1.000	1.000	0.000	1087	1.000	1.000	O00267.pdb.gz	SPT5H_HUMAN Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1
2	AFDB:Q9DDT5	0.402	0.403	0.000	1084	0.876	0.878	Q9DDT5.pdb.gz	SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio OX=7955 GN=supt5h PE=1 SV=1
3	PDB:6tedZ	0.251	0.463	3.242E-75	510	0.465	0.990	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
4	PDB:7okyZ	0.221	0.567	9.142E-59	374	0.343	0.997	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
5	AFDB:F4JW79	0.191	0.143	2.626E-42	1493	0.212	0.154	F4JW79.pdb.gz	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
6	AFDB:Q8TEJ3	0.060	0.069	1.120E-8	882	0.119	0.146	Q8TEJ3.pdb.gz	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2
7	PDB:4zn3A	0.081	0.518	1.442E-8	147	0.029	0.211	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
8	PDB:3p8bB	0.094	0.537	1.607E-8	147	0.035	0.259	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
9	PDB:7nkxZ	0.080	0.518	7.734E-8	156	0.029	0.205	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
10	PDB:7abi7	0.098	0.420	1.743E-7	236	0.021	0.097	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
11	AFDB:Q6TXD4	0.055	0.041	4.710E-7	1580	0.080	0.055	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
12	PDB:2exuA	0.083	0.451	1.042E-6	192	0.026	0.146	2exuA.pdb.gz	Crystal Structure of Saccharomyces cerevisiae transcription elongation factors Spt4-Spt5NGN domain
13	AFDB:A1X283	0.062	0.071	1.927E-6	911	0.110	0.132	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
14	AFDB:Q9VA36	0.062	0.071	2.742E-5	882	0.065	0.080	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
15	PDB:6fyxp	0.064	0.093	4.269E-4	647	0.049	0.082	6fyxp.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
16	AFDB:A0A024R657	0.057	0.053	5.116E-4	1257	0.134	0.116	A0A024R657.pdb.gz
17	PDB:7un3A	0.054	0.074	6.952E-4	649	0.044	0.074	7un3A.pdb.gz
18	PDB:6ybt1	0.054	0.091	8.179E-4	588	0.055	0.102	6ybt1.pdb.gz
19	AFDB:Q12888	0.064	0.039	9.802E-4	1972	0.139	0.077	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
20	AFDB:Q8IXT5	0.088	0.094	5.259E-3	1001	0.092	0.100	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2Q689	0.0	2171	1079	0.972	0.980	A0A1W2Q689_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=2
2	A0A1W2Q6F0	0.0	1978	1030	0.906	0.956	A0A1W2Q6F0_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=2
3	A0A8I5ZQE4	0.0	2183	1083	0.976	0.980	A0A8I5ZQE4_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=1
4	A0A8I5ZR84	0.0	1917	1163	0.902	0.844	A0A8I5ZR84_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=1
5	E9PTB2	0.0	1917	1067	0.939	0.957	E9PTB2_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=3
6	O00267	0.0	2241	1087	1.000	1.000	SPT5H_HUMAN Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1
7	O55201	0.0	2180	1082	0.974	0.979	SPT5H_MOUSE Transcription elongation factor SPT5 OS=Mus musculus OX=10090 GN=Supt5h PE=1 SV=1
8	Q21338	0.0	681	1208	0.399	0.359	SPT5H_CAEEL Transcription elongation factor SPT5 OS=Caenorhabditis elegans OX=6239 GN=spt-5 PE=3 SV=3
9	Q9DDT5	0.0	1840	1084	0.845	0.847	SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio OX=7955 GN=supt5h PE=1 SV=1
10	Q9V460	0.0	1019	1078	0.512	0.517	SPT5H_DROME Transcription elongation factor SPT5 OS=Drosophila melanogaster OX=7227 GN=Spt5 PE=1 SV=1
11	O13936	2.34e-135	436	990	0.285	0.313	SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt5 PE=1 SV=1
12	Q5ALX3	3.03e-75	270	956	0.203	0.231	SPT5_CANAL Transcription elongation factor SPT5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT5 PE=3 SV=1
13	P27692	6.14e-72	262	1063	0.205	0.210	SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT5 PE=1 SV=1
14	F4JW79	2.40e-30	132	1493	0.086	0.062	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
15	Q586U1	3.07e-29	127	715	0.134	0.204	Q586U1_TRYB2 Transcription initiation protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.65 PE=3 SV=1
16	Q8TZK1	1.39e-06	51.2	152	0.040	0.289	SPT5_PYRFU Transcription elongation factor Spt5 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=spt5 PE=1 SV=1
17	M9PC48	1.68e-06	55.1	18095	0.037	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PCJ6	2.05e-06	54.7	18641	0.037	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PBZ0	8.25e-06	52.8	22830	0.037	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PB30	8.32e-06	52.8	22949	0.037	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17384 DUF150_C	4	19.0	RimP C-terminal SH3 domain
2	PF13051 DUF3912	3.5	19.2	Protein of unknown function (DUF3912)
3	PF00467 KOW	5.2e-27	104.1	KOW motif
4	PF08584 Ribonuc_P_40	2.2e+02	12.6	Ribonuclease P 40kDa (Rpp40) subunit
5	PF03439 Spt5-NGN	2.5e-23	93.1	Early transcription elongation factor of RNA pol II, NGN section
6	PF11942 Spt5_N	4.2e-12	58.3	Spt5 transcription elongation factor, acidic N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219252	0.999	DNA-directed RNA polymerase II subunit RPB3
2	9606.ENSP00000225504	0.999	Transcription elongation factor SPT4
3	9606.ENSP00000301788	0.999	DNA-directed RNA polymerase II subunit RPB7
4	9606.ENSP00000319104	0.999	Transcription elongation factor SPT6
5	9606.ENSP00000370625	0.999	DNA-directed RNA polymerase II subunit RPB2
6	9606.ENSP00000374280	0.999	RNA polymerase-associated protein RTF1 homolog
7	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
8	9606.ENSP00000299601	0.998	RNA polymerase-associated protein LEO1
9	9606.ENSP00000355013	0.998	RNA polymerase-associated protein CTR9 homolog
10	9606.ENSP00000403852	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC2
11	9606.ENSP00000478303	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC1
12	9606.ENSP00000216297	0.997	FACT complex subunit SPT16
13	9606.ENSP00000272645	0.995	DNA-directed RNA polymerase II subunit RPB4
14	9606.ENSP00000356405	0.995	Parafibromin
15	9606.ENSP00000358497	0.995	mRNA-capping enzyme
16	9606.ENSP00000221859	0.994	DNA-directed RNA polymerase II subunit RPB9
17	9606.ENSP00000372335	0.994	Negative elongation factor A
18	9606.ENSP00000339495	0.993	Negative elongation factor B
19	9606.ENSP00000295321	0.992	Protein IWS1 homolog
20	9606.ENSP00000428426	0.991	Transcription elongation factor A protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	1.000	protein dimerization activity
GO:0019899	0.999	enzyme binding
GO:0003723	0.999	RNA binding
GO:0003682	0.995	chromatin binding
GO:0046982	0.994	protein heterodimerization activity
GO:0003677	0.882	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0051173	0.968	positive regulation of nitrogen compound metabolic process
GO:0031325	0.968	positive regulation of cellular metabolic process
GO:0045935	0.962	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.951	regulation of transcription by RNA polymerase II
GO:0045893	0.948	positive regulation of DNA-templated transcription
GO:0045944	0.936	positive regulation of transcription by RNA polymerase II
GO:0071704	0.716	organic substance metabolic process
GO:0009987	0.706	cellular process
GO:0044238	0.690	primary metabolic process
GO:0006807	0.674	nitrogen compound metabolic process
GO:0043170	0.665	macromolecule metabolic process
GO:0044237	0.657	cellular metabolic process
GO:0006139	0.535	nucleobase-containing compound metabolic process
GO:0090304	0.534	nucleic acid metabolic process
GO:0010467	0.462	gene expression
GO:0016070	0.437	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0140513	0.875	nuclear protein-containing complex
GO:0008023	0.711	transcription elongation factor complex
GO:0005737	0.617	cytoplasm
GO:0032044	0.476	DSIF complex
GO:0043228	0.436	non-membrane-bounded organelle
GO:0043232	0.430	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]