StarFunc result for job id O00268

User Input

>input (1085 residues)
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQT
LAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATT
SGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATL
QRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRS
LPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTP
QQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00268	0.999	0.999	0.000	1085	1.000	1.000	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
2	AFDB:E9QAP7	0.302	0.313	8.974E-103	1042	0.843	0.878	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
3	PDB:7egdD	0.117	0.458	1.088E-18	197	0.182	1.000	7egdD.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	PDB:7edxd	0.106	0.548	2.596E-14	158	0.146	1.000	7edxd.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	AFDB:Q8BI84	0.065	0.042	1.148E-5	1930	0.146	0.082	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
6	AFDB:D3Z8E6	0.045	0.035	1.465E-4	1604	0.156	0.105	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
7	AFDB:Q8CGM2	0.050	0.036	2.964E-4	1859	0.155	0.090	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
8	AFDB:F4IUY8	0.039	0.041	3.487E-4	1006	0.105	0.113	F4IUY8.pdb.gz	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1
9	AFDB:Q10124	0.047	0.036	1.590E-3	1647	0.196	0.129	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
10	AFDB:Q5JRA6	0.055	0.037	1.590E-3	1907	0.125	0.071	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
11	AFDB:Q90623	0.047	0.049	2.734E-3	1004	0.092	0.100	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
12	AFDB:Q86BM5	0.045	0.043	3.217E-3	837	0.124	0.160	Q86BM5.pdb.gz	Q86BM5_DROME A kinase anchor protein 200, isoform D OS=Drosophila melanogaster OX=7227 GN=Akap200 PE=1 SV=1
13	PDB:2jmhA	0.047	0.302	1.791	117	0.018	0.162	2jmhA.pdb.gz
14	PDB:5ynxA	0.052	0.300	2.617	117	0.015	0.137	5ynxA.pdb.gz
15	PDB:5fn5B	0.035	0.125	3.825	223	0.008	0.040	5fn5B.pdb.gz
16	PDB:1buyA	0.041	0.175	4.038	166	0.020	0.133	1buyA.pdb.gz
17	PDB:6e0cA	0.046	0.389	4.262	99	0.010	0.111	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
18	PDB:7on1e	0.052	0.464	4.750	97	0.011	0.124	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
19	PDB:5a1vK	0.044	0.043	5.015	1126	0.011	0.011	5a1vK.pdb.gz
20	PDB:1gvnA	0.040	0.303	5.294	87	0.009	0.115	1gvnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K849	0.0	1187	1038	0.606	0.634	A0A0G2K849_RAT TATA-box binding protein associated factor 4 OS=Rattus norvegicus OX=10116 GN=Taf4 PE=1 SV=2
2	A0A2I3BPN6	0.0	1170	1030	0.600	0.632	A0A2I3BPN6_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
3	E9QAP7	0.0	1196	1042	0.609	0.634	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1
4	O00268	0.0	2088	1085	1.000	1.000	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
5	Q91WW6	0.0	1154	662	0.572	0.938	Q91WW6_MOUSE TATA-binding protein associated factor TAFII135 (Fragment) OS=Mus musculus OX=10090 GN=Taf4 PE=2 SV=1
6	Q92750	2.21e-110	366	862	0.162	0.204	TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens OX=9606 GN=TAF4B PE=1 SV=2
7	J3KTH2	2.61e-110	366	867	0.162	0.203	J3KTH2_HUMAN HCG38478, isoform CRA_a OS=Homo sapiens OX=9606 GN=TAF4B PE=1 SV=1
8	G5E8Z2	6.87e-102	342	850	0.154	0.196	TAF4B_MOUSE Transcription initiation factor TFIID subunit 4B OS=Mus musculus OX=10090 GN=Taf4b PE=1 SV=2
9	P47825	1.96e-69	253	921	0.124	0.145	TAF4_DROME Transcription initiation factor TFIID subunit 4 OS=Drosophila melanogaster OX=7227 GN=Taf4 PE=1 SV=1
10	O61707	4.75e-11	68.9	523	0.038	0.078	TAF4_CAEEL Transcription initiation factor TFIID subunit 4 OS=Caenorhabditis elegans OX=6239 GN=taf-4 PE=1 SV=2
11	Q6SJR1	7.45e-11	68.9	720	0.054	0.082	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02969 TAF	63	15.2	TATA box binding protein associated factor (TAF)
2	PF05236 TAF4	7.6e-74	260.5	Transcription initiation factor TFIID component TAF4 family
3	PF07531 TAFH	2.7e-37	138.0	NHR1 homology to TAF
4	PF00749 tRNA-synt_1c	9.5e+02	10.0	tRNA synthetases class I (E and Q), catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
2	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
3	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
4	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
5	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
6	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
7	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
8	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
9	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
10	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
11	9606.ENSP00000375942	0.999	TATA-box-binding protein
12	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
13	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
14	9606.ENSP00000387699	0.998	Cyclic AMP-responsive element-binding protein 1
15	9606.ENSP00000339917	0.997	Transcription initiation factor TFIID subunit 9B
16	9606.ENSP00000379372	0.991	Transcription initiation factor IIA subunit 2
17	9606.ENSP00000347184	0.988	Huntingtin
18	9606.ENSP00000418379	0.988	Transcription initiation factor TFIID subunit 1-like
19	9606.ENSP00000294168	0.982	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
20	9606.ENSP00000352925	0.982	Transformation/transcription domain-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0008134	0.983	transcription factor binding
GO:0016251	0.946	RNA polymerase II general transcription initiation factor activity
GO:0043565	0.905	sequence-specific DNA binding
GO:0140297	0.894	DNA-binding transcription factor binding
GO:0061629	0.845	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1990837	0.834	sequence-specific double-stranded DNA binding
GO:0017162	0.646	aryl hydrocarbon receptor binding
GO:0000976	0.620	transcription cis-regulatory region binding
GO:0001046	0.587	core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0050789	0.957	regulation of biological process
GO:0050794	0.954	regulation of cellular process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0080090	0.929	regulation of primary metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0031323	0.928	regulation of cellular metabolic process
GO:0010468	0.928	regulation of gene expression
GO:0010467	0.899	gene expression
GO:0016070	0.898	RNA metabolic process
GO:0006355	0.897	regulation of DNA-templated transcription
GO:1901576	0.887	organic substance biosynthetic process
GO:0044249	0.887	cellular biosynthetic process
GO:1901362	0.880	organic cyclic compound biosynthetic process
GO:0044271	0.880	cellular nitrogen compound biosynthetic process
GO:0048522	0.878	positive regulation of cellular process
GO:0009059	0.873	macromolecule biosynthetic process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0034654	0.869	nucleobase-containing compound biosynthetic process
GO:0051173	0.867	positive regulation of nitrogen compound metabolic process
GO:0031325	0.857	positive regulation of cellular metabolic process
GO:0006357	0.849	regulation of transcription by RNA polymerase II
GO:0032502	0.847	developmental process
GO:0032501	0.845	multicellular organismal process
GO:0006351	0.835	DNA-templated transcription
GO:0051254	0.830	positive regulation of RNA metabolic process
GO:0010557	0.829	positive regulation of macromolecule biosynthetic process
GO:0031328	0.829	positive regulation of cellular biosynthetic process
GO:0036211	0.822	protein modification process
GO:0045893	0.819	positive regulation of DNA-templated transcription
GO:0006366	0.809	transcription by RNA polymerase II
GO:0071840	0.735	cellular component organization or biogenesis
GO:0001541	0.732	ovarian follicle development
GO:0016043	0.727	cellular component organization
GO:0045944	0.690	positive regulation of transcription by RNA polymerase II
GO:0016570	0.684	histone modification
GO:0006473	0.488	protein acetylation
GO:0018205	0.486	peptidyl-lysine modification
GO:0016573	0.459	histone acetylation
GO:0016071	0.433	mRNA metabolic process
GO:0070647	0.422	protein modification by small protein conjugation or removal
GO:0006508	0.366	proteolysis
GO:0006352	0.358	DNA-templated transcription initiation
GO:0065003	0.353	protein-containing complex assembly
GO:0016579	0.328	protein deubiquitination
GO:0006367	0.321	transcription initiation at RNA polymerase II promoter
GO:2000142	0.309	regulation of DNA-templated transcription initiation
GO:0043966	0.308	histone H3 acetylation
GO:0060260	0.304	regulation of transcription initiation by RNA polymerase II
GO:0016578	0.300	histone deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0005654	0.989	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0140513	0.978	nuclear protein-containing complex
GO:1902494	0.977	catalytic complex
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:1990234	0.962	transferase complex
GO:0140535	0.805	intracellular protein-containing complex
GO:0005737	0.769	cytoplasm
GO:0016591	0.702	RNA polymerase II, holoenzyme
GO:0005669	0.593	transcription factor TFIID complex
GO:0031248	0.558	protein acetyltransferase complex
GO:0070461	0.532	SAGA-type complex
GO:0035097	0.512	histone methyltransferase complex
GO:0005829	0.455	cytosol
GO:0071339	0.428	MLL1 complex
GO:0043073	0.370	germ cell nucleus
GO:0033276	0.366	transcription factor TFTC complex
GO:0001673	0.307	male germ cell nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]