StarFunc result for job id O00273

User Input

>input (331 residues)
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00273	1.000	1.000	7.610E-55	331	1.000	1.000	O00273.pdb.gz	DFFA_HUMAN DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1
2	AFDB:O54786	0.512	0.512	4.735E-44	331	0.761	0.761	O54786.pdb.gz	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
3	AFDB:O61464	0.235	0.259	4.485E-10	299	0.145	0.161	O61464.pdb.gz	O61464_DROME DNAation factor DREP-1 OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=1 SV=1
4	AFDB:O70302	0.244	0.364	2.339E-8	217	0.112	0.171	O70302.pdb.gz	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
5	AFDB:Q8N5P9	0.258	0.335	5.157E-8	253	0.109	0.142	Q8N5P9.pdb.gz	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
6	AFDB:Q9UHD4	0.257	0.383	2.808E-7	219	0.079	0.119	Q9UHD4.pdb.gz	CIDEB_HUMAN Lipid transferase CIDEB OS=Homo sapiens OX=9606 GN=CIDEB PE=1 SV=2
7	AFDB:P56198	0.237	0.326	3.326E-7	239	0.103	0.142	P56198.pdb.gz	CIDEC_MOUSE Lipid transferase CIDEC OS=Mus musculus OX=10090 GN=Cidec PE=1 SV=2
8	AFDB:Q96AQ7	0.249	0.342	8.212E-7	238	0.103	0.143	Q96AQ7.pdb.gz	CIDEC_HUMAN Lipid transferase CIDEC OS=Homo sapiens OX=9606 GN=CIDEC PE=1 SV=1
9	AFDB:A8DY77	0.237	0.145	5.006E-6	549	0.085	0.051	A8DY77.pdb.gz	A8DY77_DROME DNAation factor-related protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
10	AFDB:Q99N34	0.240	0.228	7.025E-6	349	0.115	0.109	Q99N34.pdb.gz	DFFB_RAT DNA fragmentation factor subunit beta OS=Rattus norvegicus OX=10116 GN=Dffb PE=1 SV=1
11	PDB:7rbsB	0.184	0.363	1.457E-2	157	0.036	0.076	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:5xqmA	0.188	0.590	1.726E-2	90	0.033	0.122	5xqmA.pdb.gz
13	PDB:4atuI	0.200	0.548	2.869E-2	106	0.042	0.132	4atuI.pdb.gz	Molecular Basis for Specific Regulation of Neuronal Kinesin- 3 Motors by Doublecortin Family Proteins.
14	PDB:6yvaC	0.185	0.370	3.597E-2	155	0.021	0.045	6yvaC.pdb.gz
15	PDB:3ai5A	0.185	0.204	4.261E-2	299	0.021	0.023	3ai5A.pdb.gz
16	PDB:2k1fA	0.180	0.541	6.327E-2	88	0.030	0.114	2k1fA.pdb.gz
17	PDB:3plvA	0.180	0.643	7.496E-2	80	0.024	0.100	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
18	PDB:6ef3u	0.182	0.670	8.880E-2	75	0.021	0.093	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
19	PDB:1wz0A	0.189	0.519	9.942E-2	104	0.036	0.115	1wz0A.pdb.gz
20	PDB:4pyuA	0.181	0.683	9.942E-2	76	0.027	0.118	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00273	0.0	667	331	1.000	1.000	DFFA_HUMAN DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1
2	O54786	0.0	510	331	0.761	0.761	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
3	Q498U6	1.21e-148	420	265	0.628	0.785	Q498U6_RAT DNA fragmentation factor subunit alpha OS=Rattus norvegicus OX=10116 GN=Dffa PE=1 SV=1
4	A0A8I6ANF5	5.07e-124	358	275	0.541	0.651	A0A8I6ANF5_RAT DNA fragmentation factor subunit alpha OS=Rattus norvegicus OX=10116 GN=Dffa PE=1 SV=1
5	O70302	4.74e-10	60.8	217	0.100	0.152	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
6	P56198	2.78e-09	58.9	239	0.097	0.134	CIDEC_MOUSE Lipid transferase CIDEC OS=Mus musculus OX=10090 GN=Cidec PE=1 SV=2
7	O60543	3.26e-09	58.5	219	0.100	0.151	CIDEA_HUMAN Lipid transferase CIDEA OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
8	Q8N5P9	3.65e-09	58.9	253	0.100	0.130	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
9	Q96AQ7	3.86e-06	49.7	238	0.091	0.126	CIDEC_HUMAN Lipid transferase CIDEC OS=Homo sapiens OX=9606 GN=CIDEC PE=1 SV=1
10	Q7K304	1.52e-04	45.8	482	0.091	0.062	Q7K304_DROME DNAation factor-related protein 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
11	Q9U787	1.52e-04	45.8	481	0.091	0.062	Q9U787_DROME Drep2 OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
12	A0A0B4KFF6	2.47e-04	45.1	497	0.091	0.060	A0A0B4KFF6_DROME DNAation factor-related protein 2, isoform D OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
13	A8DY77	2.83e-04	45.1	549	0.082	0.049	A8DY77_DROME DNAation factor-related protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep2 PE=1 SV=1
14	Q9UHD4	3.02e-04	43.9	219	0.076	0.114	CIDEB_HUMAN Lipid transferase CIDEB OS=Homo sapiens OX=9606 GN=CIDEB PE=1 SV=2
15	O61464	5.57e-04	43.5	299	0.088	0.097	O61464_DROME DNAation factor DREP-1 OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=1 SV=1
16	Q6NR36	5.85e-04	43.5	297	0.088	0.098	Q6NR36_DROME DNAation factor-related protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=2 SV=1
17	A0A0B4KFQ3	5.95e-04	43.5	306	0.088	0.095	A0A0B4KFQ3_DROME DNAation factor-related protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=4 SV=1
18	O70303	0.003	40.8	219	0.079	0.119	CIDEB_MOUSE Lipid transferase CIDEB OS=Mus musculus OX=10090 GN=Cideb PE=1 SV=2
19	D3ZKI3	0.015	38.9	264	0.076	0.095	D3ZKI3_RAT Cell death-inducing DFFA-like effector b OS=Rattus norvegicus OX=10116 GN=Cideb PE=4 SV=3
20	A0A8I6ASG0	0.019	38.1	206	0.076	0.121	A0A8I6ASG0_RAT Cell death-inducing DFFA-like effector b OS=Rattus norvegicus OX=10116 GN=Cideb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08672 ANAPC2	8.2e+02	11.9	Anaphase promoting complex (APC) subunit 2
2	PF02017 CIDE-N	2.4e-24	96.5	CIDE-N domain
3	PF09033 DFF-C	4.4e-71	249.6	DNA Fragmentation factor 45kDa, C terminal domain
4	PF16722 SAPIS-gp6	1.6e+02	14.1	Pathogenicity island protein gp6 in Staphylococcus
5	PF15934 Yuri_gagarin	6.9	18.0	Yuri gagarin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339524	0.999	DNA fragmentation factor subunit beta
2	9606.ENSP00000311032	0.990	Caspase-3
3	9606.ENSP00000216341	0.922	Granzyme B
4	9606.ENSP00000337731	0.916	Cell death activator CIDE-B
5	9606.ENSP00000358327	0.758	Caspase-7
6	9606.ENSP00000373328	0.739	Cell death activator CIDE-3
7	9606.ENSP00000222219	0.731	Deoxyribonuclease-2-alpha
8	9606.ENSP00000306106	0.651	Protein jagunal homolog 1
9	9606.ENSP00000307786	0.650	Cytochrome c
10	9606.ENSP00000282030	0.644	SET binding protein 1
11	9606.ENSP00000364166	0.641	Transmembrane protein 225
12	9606.ENSP00000351273	0.630	Caspase-8
13	9606.ENSP00000330237	0.629	Caspase-9
14	9606.ENSP00000378323	0.618	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
15	9606.ENSP00000290158	0.616	Importin subunit beta-1
16	9606.ENSP00000411565	0.614	Dehydrogenase/reductase SDR family member 12
17	9606.ENSP00000334437	0.612	Nucleoside diphosphate-linked moiety X motif 17
18	9606.ENSP00000448165	0.601	Apoptotic protease-activating factor 1
19	9606.ENSP00000343701	0.600	Importin subunit alpha-5
20	9606.ENSP00000265164	0.567	Caspase-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.987	molecular function regulator activity
GO:0019904	0.976	protein domain specific binding
GO:0030234	0.940	enzyme regulator activity
GO:0044183	0.936	protein folding chaperone
GO:0004857	0.926	enzyme inhibitor activity
GO:0060090	0.924	molecular adaptor activity
GO:0060703	0.847	deoxyribonuclease inhibitor activity
GO:0003824	0.331	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0009894	0.987	regulation of catabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0009895	0.984	negative regulation of catabolic process
GO:0051052	0.981	regulation of DNA metabolic process
GO:0010941	0.979	regulation of cell death
GO:0051172	0.977	negative regulation of nitrogen compound metabolic process
GO:0010605	0.977	negative regulation of macromolecule metabolic process
GO:0042981	0.972	regulation of apoptotic process
GO:0031329	0.967	regulation of cellular catabolic process
GO:0048523	0.961	negative regulation of cellular process
GO:0065009	0.950	regulation of molecular function
GO:0031330	0.943	negative regulation of cellular catabolic process
GO:0050790	0.933	regulation of catalytic activity
GO:0051053	0.928	negative regulation of DNA metabolic process
GO:0051336	0.912	regulation of hydrolase activity
GO:0048518	0.727	positive regulation of biological process
GO:0006915	0.631	apoptotic process
GO:0048522	0.554	positive regulation of cellular process
GO:0043068	0.361	positive regulation of programmed cell death
GO:0043086	0.353	negative regulation of catalytic activity
GO:0043065	0.352	positive regulation of apoptotic process
GO:0050896	0.344	response to stimulus
GO:0060548	0.317	negative regulation of cell death
GO:0051346	0.306	negative regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.997	membrane
GO:0032991	0.995	protein-containing complex
GO:0005886	0.993	plasma membrane
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005694	0.603	chromosome
GO:0000785	0.567	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]