StarFunc result for job id O00287

User Input

>input (272 residues)
MEAQGVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAA
PGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGG
EGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSD
QALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLR
SPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00287	1.000	1.000	5.489E-42	272	1.000	1.000	O00287.pdb.gz	RFXAP_HUMAN Regulatory factor X-associated protein OS=Homo sapiens OX=9606 GN=RFXAP PE=1 SV=1
2	AFDB:Q38CL3	0.100	0.046	1.748E-2	723	0.169	0.064	Q38CL3.pdb.gz	Q38CL3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0140 PE=4 SV=1
3	AFDB:Q3TVI8	0.107	0.050	4.360E-2	727	0.143	0.054	Q3TVI8.pdb.gz	PBIP1_MOUSE Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Mus musculus OX=10090 GN=Pbxip1 PE=1 SV=2
4	AFDB:P42774	0.116	0.104	4.677E-2	315	0.195	0.168	P42774.pdb.gz	GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=GBF1 PE=1 SV=2
5	AFDB:Q8C9S4	0.088	0.036	8.805E-2	917	0.125	0.037	Q8C9S4.pdb.gz	CC186_MOUSE Coiled-coil domain-containing protein 186 OS=Mus musculus OX=10090 GN=Ccdc186 PE=1 SV=2
6	AFDB:Q75JH1	0.101	0.056	1.087E-1	522	0.154	0.080	Q75JH1.pdb.gz	Q75JH1_DICDI RRM Nup35-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276109 PE=4 SV=1
7	AFDB:Q12983	0.110	0.114	2.196E-1	259	0.147	0.154	Q12983.pdb.gz	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
8	AFDB:F4HXQ7	0.105	0.033	2.356E-1	1113	0.132	0.032	F4HXQ7.pdb.gz	MYOB1_ARATH Myosin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MYOB1 PE=1 SV=1
9	AFDB:Q4W5Z4	0.082	0.037	2.909E-1	877	0.173	0.054	Q4W5Z4.pdb.gz	DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus OX=9031 GN=DNMT3A PE=2 SV=1
10	AFDB:Q9VHE3	0.114	0.079	3.348E-1	448	0.114	0.069	Q9VHE3.pdb.gz	Q9VHE3_DROME GH05665p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9356 PE=1 SV=1
11	PDB:4uhvB	0.071	0.037	1.339	645	0.070	0.029	4uhvB.pdb.gz
12	PDB:7v2wJ	0.117	0.133	2.704	236	0.055	0.064	7v2wJ.pdb.gz
13	PDB:6a6xC	0.104	0.259	4.744	75	0.029	0.107	6a6xC.pdb.gz
14	PDB:6kytC	0.104	0.285	5.460	73	0.033	0.123	6kytC.pdb.gz
15	PDB:1q5vB	0.065	0.142	6.284	116	0.029	0.069	1q5vB.pdb.gz
16	PDB:7yyhK	0.144	0.164	6.284	217	0.051	0.065	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
17	PDB:7kzmD	0.082	0.056	7.233	456	0.037	0.022	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
18	PDB:3f3sA	0.145	0.130	8.325	312	0.037	0.032	3f3sA.pdb.gz	The Crystal Structure of Human Lambda-Crystallin, CRYL1
19	PDB:7lxdA	0.065	0.016	8.325	1190	0.018	0.004	7lxdA.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
20	PDB:7s78P	0.099	0.185	8.325	134	0.055	0.112	7s78P.pdb.gz	Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00287	0.0	550	272	1.000	1.000	RFXAP_HUMAN Regulatory factor X-associated protein OS=Homo sapiens OX=9606 GN=RFXAP PE=1 SV=1
2	Q8VCG9	9.61e-68	211	231	0.680	0.801	RFXAP_MOUSE Regulatory factor X-associated protein OS=Mus musculus OX=10090 GN=Rfxap PE=2 SV=2
3	Q4G0N4	0.81	33.5	442	0.099	0.061	NAKD2_HUMAN NAD kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=NADK2 PE=1 SV=2
4	Q8C5H8	2.1	32.3	452	0.096	0.058	NAKD2_MOUSE NAD kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Nadk2 PE=1 SV=2
5	B7Z8V7	2.2	32.0	301	0.099	0.090	B7Z8V7_HUMAN NAD kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=NADK2 PE=1 SV=1
6	Q9I4U2	3.7	31.6	847	0.074	0.024	QUIP_PSEAE Acyl-homoserine lactone acylase QuiP OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=quiP PE=1 SV=1
7	Q4QBN6	5.2	31.2	5635	0.092	0.004	Q4QBN6_LEIMA Putative dynein heavy chain, cytosolic OS=Leishmania major OX=5664 GN=LMJF_22_1110 PE=4 SV=1
8	Q1LUQ2	7.8	30.4	566	0.059	0.028	Q1LUQ2_DANRE TIR domain-containing adapter molecule 1 OS=Danio rerio OX=7955 GN=trif PE=2 SV=1
9	A9NJG3	9.5	30.4	1147	0.121	0.029	A9NJG3_SALSA Na/K/2Cl co-transporter OS=Salmo salar OX=8030 GN=NKCC1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15289 RFXA_RFXANK_bdg	1.5e-60	214.2	Regulatory factor X-associated C-terminal binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290524	0.999	DNA-binding protein RFX5
2	9606.ENSP00000305071	0.999	DNA-binding protein RFXANK
3	9606.ENSP00000485010	0.951	MHC class II transactivator
4	9606.ENSP00000254325	0.832	MHC class II regulatory factor RFX1
5	9606.ENSP00000296785	0.687	Ankyrin repeat family A protein 2
6	9606.ENSP00000453281	0.682	DNA-binding protein RFX7
7	9606.ENSP00000261180	0.680	Thyrotropin-releasing hormone-degrading ectoenzyme
8	9606.ENSP00000369154	0.661	Mothers against decapentaplegic homolog 9
9	9606.ENSP00000322885	0.659	Probable E3 ubiquitin-protein ligase DTX2
10	9606.ENSP00000333012	0.645	Calcium-responsive transactivator
11	9606.ENSP00000374529	0.632	Cyclin-K
12	9606.ENSP00000380283	0.628	Probable G-protein coupled receptor 146
13	9606.ENSP00000306335	0.626	DNA-binding protein RFX2
14	9606.ENSP00000257600	0.606	E3 ubiquitin-protein ligase DTX1
15	9606.ENSP00000362296	0.604	POU domain, class 3, transcription factor 4
16	9606.ENSP00000416154	0.600	Transmembrane protein 238
17	9606.ENSP00000395654	0.556	Transcription activator BRG1
18	9606.ENSP00000396620	0.547	Nuclear transcription factor Y subunit gamma
19	9606.ENSP00000378786	0.539	HLA class II histocompatibility antigen, DR alpha chain
20	9606.ENSP00000345702	0.531	Nuclear transcription factor Y subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:0051173	0.971	positive regulation of nitrogen compound metabolic process
GO:0031325	0.965	positive regulation of cellular metabolic process
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0045893	0.959	positive regulation of DNA-templated transcription
GO:0045944	0.914	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0140513	0.989	nuclear protein-containing complex
GO:0005667	0.984	transcription regulator complex
GO:0090575	0.964	RNA polymerase II transcription regulator complex
GO:0016604	0.923	nuclear body
GO:0016607	0.810	nuclear speck
GO:0005737	0.664	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]