StarFunc result for job id O00291

User Input

>input (1037 residues)
MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINTQEVAVKEKHA
RTCILGTHHEKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRNE
LSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNN
FFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTV
KLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPF
NFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQ
HLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQ
NHADLLRKNAEVTKQVSMARQAQVDLEREKKELEDSLERISDQGQRKTQEQLEVLESLKQ
ELATSQRELQVLQGSLETSAQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQD
TQLKLASTEESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLST
VTSISSCIEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADS
LTEACKQYGRETLAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEELG
DLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVA
SKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKF
EELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQI
EETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEE
GTEASPPTLQEVVTEKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V8Y8	0.404	0.407	0.000	1030	0.873	0.879	G3V8Y8.pdb.gz	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
2	AFDB:O00291	1.000	1.000	0.000	1037	1.000	1.000	O00291.pdb.gz	HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1 PE=1 SV=5
3	AFDB:A0A2R8QB02	0.362	0.357	1.285E-86	1056	0.669	0.657	A0A2R8QB02.pdb.gz
4	AFDB:F1MUI0	0.611	0.591	7.068E-75	1076	0.505	0.487	F1MUI0.pdb.gz	F1MUI0_BOVIN Huntingtin interacting protein 1 related OS=Bos taurus OX=9913 GN=HIP1R PE=1 SV=2
5	AFDB:Q99PW9	0.631	0.609	1.466E-74	1079	0.502	0.483	Q99PW9.pdb.gz	Q99PW9_RAT Huntingtin interacting protein 1 related (Fragment) OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
6	AFDB:Q02328	0.291	0.323	9.875E-52	927	0.306	0.342	Q02328.pdb.gz	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
7	AFDB:Q2U538	0.372	0.347	1.337E-39	1136	0.254	0.232	Q2U538.pdb.gz	Q2U538_ASPOR Cytoskeleton assembly control protein Sla2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000087 PE=3 SV=1
8	AFDB:Q9P6L5	0.294	0.280	5.510E-39	1102	0.252	0.237	Q9P6L5.pdb.gz	SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=end4 PE=1 SV=2
9	AFDB:A0A1D8PRF5	0.245	0.239	1.019E-37	1063	0.251	0.245	A0A1D8PRF5.pdb.gz	A0A1D8PRF5_CANAL Sla2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA2 PE=3 SV=1
10	AFDB:Q1ZXE9	0.243	0.262	1.195E-32	960	0.215	0.232	Q1ZXE9.pdb.gz	Q1ZXE9_DICDI I/LWEQ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hipA PE=3 SV=1
11	PDB:6r9tA	0.195	0.102	3.108E-8	2185	0.072	0.034	6r9tA.pdb.gz
12	PDB:3ay5A	0.133	0.426	2.475E-3	298	0.031	0.107	3ay5A.pdb.gz
13	PDB:4iggB	0.091	0.113	4.579E-2	771	0.053	0.071	4iggB.pdb.gz
14	PDB:6xz6A	0.044	0.169	8.000E-2	213	0.027	0.131	6xz6A.pdb.gz
15	PDB:6xz4A	0.080	0.251	1.659E-1	304	0.041	0.138	6xz4A.pdb.gz
16	PDB:7rroB1	0.078	0.141	4.451E-1	416	0.055	0.137	7rroB1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7ungA1	0.073	0.141	5.063E-1	391	0.054	0.143	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:7rroA1	0.086	0.178	5.758E-1	396	0.060	0.157	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:3o7qA	0.077	0.151	6.011E-1	414	0.036	0.089	3o7qA.pdb.gz
20	PDB:6nr7A	0.060	0.058	6.011E-1	1086	0.037	0.035	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6T0	0.0	1792	1008	0.845	0.869	A0A8I5Y6T0_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
2	A0A8I6AA26	0.0	1793	1004	0.845	0.873	A0A8I6AA26_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
3	A0A8I6GA90	0.0	1803	1015	0.857	0.876	A0A8I6GA90_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=1 SV=1
4	B5DFK5	0.0	996	1068	0.517	0.502	B5DFK5_RAT Hip1r protein OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
5	C9K4U5	0.0	1412	1046	0.676	0.670	C9K4U5_DANRE Huntingtin-interacting protein 1 OS=Danio rerio OX=7955 GN=wu:fb98d04 PE=1 SV=1
6	F1LML7	0.0	996	1069	0.518	0.502	F1LML7_RAT Huntingtin interacting protein 1 related OS=Rattus norvegicus OX=10116 GN=Hip1r PE=1 SV=1
7	F1MUI0	0.0	987	1076	0.513	0.494	F1MUI0_BOVIN Huntingtin interacting protein 1 related OS=Bos taurus OX=9913 GN=HIP1R PE=1 SV=2
8	F1R6L2	0.0	1405	1048	0.673	0.666	F1R6L2_DANRE Huntingtin-interacting protein 1 OS=Danio rerio OX=7955 GN=wu:fb98d04 PE=1 SV=3
9	G3V8Y8	0.0	1875	1038	0.882	0.882	G3V8Y8_RAT Huntingtin interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Hip1 PE=3 SV=2
10	O00291	0.0	2135	1037	1.000	1.000	HIP1_HUMAN Huntingtin-interacting protein 1 OS=Homo sapiens OX=9606 GN=HIP1 PE=1 SV=5
11	O75146	0.0	995	1068	0.510	0.495	HIP1R_HUMAN Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R PE=1 SV=2
12	Q8VD75	0.0	1849	1029	0.879	0.886	HIP1_MOUSE Huntingtin-interacting protein 1 OS=Mus musculus OX=10090 GN=Hip1 PE=1 SV=2
13	Q99PW9	0.0	995	1079	0.518	0.498	Q99PW9_RAT Huntingtin interacting protein 1 related (Fragment) OS=Rattus norvegicus OX=10116 GN=Hip1r PE=2 SV=1
14	Q9JKY5	0.0	977	1068	0.510	0.495	HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus OX=10090 GN=Hip1r PE=1 SV=2
15	Q8VHU1	2.54e-143	429	230	0.203	0.913	Q8VHU1_RAT HIP1 protein (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
16	Q02328	1.04e-84	296	927	0.174	0.194	SLAP2_CAEEL Huntington interacting protein related 1 OS=Caenorhabditis elegans OX=6239 GN=hipr-1 PE=3 SV=3
17	Q2U538	2.14e-43	174	1136	0.144	0.131	Q2U538_ASPOR Cytoskeleton assembly control protein Sla2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000087 PE=3 SV=1
18	Q9P6L5	3.65e-40	164	1102	0.089	0.083	SLA2_SCHPO Endocytosis protein end4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=end4 PE=1 SV=2
19	A0A1D8PRF5	3.23e-36	151	1063	0.177	0.173	A0A1D8PRF5_CANAL Sla2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA2 PE=3 SV=1
20	Q1ZXE9	6.90e-29	127	960	0.134	0.145	Q1ZXE9_DICDI I/LWEQ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hipA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07651 ANTH	2.9e-77	271.0	ANTH domain
2	PF11802 CENP-K	17	16.4	Centromere-associated protein K
3	PF00038 Filament	11	17.1	Intermediate filament protein
4	PF16515 HIP1_clath_bdg	5.4e-27	105.4	Clathrin-binding domain of Huntingtin-interacting protein 1
5	PF01608 I_LWEQ	4.6e-50	181.1	I/LWEQ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336747

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309415	0.988	Clathrin light chain B
2	9606.ENSP00000479606	0.987	Clathrin heavy chain 1
3	9606.ENSP00000347184	0.986	Huntingtin
4	9606.ENSP00000242285	0.945	Clathrin light chain A
5	9606.ENSP00000264538	0.942	Intraflagellar transport protein 57 homolog
6	9606.ENSP00000441158	0.938	Clathrin heavy chain 2
7	9606.ENSP00000351926	0.925	AP-2 complex subunit alpha-1
8	9606.ENSP00000351273	0.894	Caspase-8
9	9606.ENSP00000417653	0.890	Drebrin-like protein
10	9606.ENSP00000367220	0.869	Actin-related protein 2
11	9606.ENSP00000482835	0.856	AP-2 complex subunit beta
12	9606.ENSP00000311032	0.853	Caspase-3
13	9606.ENSP00000327694	0.847	AP-2 complex subunit alpha-2
14	9606.ENSP00000263270	0.835	AP-2 complex subunit sigma
15	9606.ENSP00000292807	0.828	AP-2 complex subunit mu
16	9606.ENSP00000314499	0.808	Cyclin-G-associated kinase
17	9606.ENSP00000262866	0.757	Src-like-adapter 2
18	9606.ENSP00000365745	0.747	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
19	9606.ENSP00000320176	0.742	Hematopoietic lineage cell-specific protein
20	9606.ENSP00000354772	0.726	Multivesicular body subunit 12B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0030276	0.991	clathrin binding
GO:0044877	0.959	protein-containing complex binding
GO:0051015	0.924	actin filament binding
GO:0140312	0.877	cargo adaptor activity
GO:0005200	0.707	structural constituent of cytoskeleton
GO:0035615	0.674	clathrin adaptor activity
GO:0080025	0.593	phosphatidylinositol-3,5-bisphosphate binding
GO:0043325	0.591	phosphatidylinositol-3,4-bisphosphate binding
GO:0032266	0.562	phosphatidylinositol-3-phosphate binding
GO:0042802	0.487	identical protein binding
GO:0046982	0.449	protein heterodimerization activity
GO:0042803	0.365	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0006810	0.952	transport
GO:0016043	0.942	cellular component organization
GO:0022607	0.878	cellular component assembly
GO:0065007	0.858	biological regulation
GO:0050789	0.849	regulation of biological process
GO:0050794	0.810	regulation of cellular process
GO:0065003	0.761	protein-containing complex assembly
GO:0016192	0.562	vesicle-mediated transport
GO:0006897	0.540	endocytosis
GO:0051128	0.404	regulation of cellular component organization
GO:0048518	0.380	positive regulation of biological process
GO:0048522	0.361	positive regulation of cellular process
GO:0032879	0.342	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.999	synapse
GO:0031410	0.999	cytoplasmic vesicle
GO:0005886	0.998	plasma membrane
GO:0030136	0.992	clathrin-coated vesicle
GO:0098590	0.987	plasma membrane region
GO:0098794	0.985	postsynapse
GO:0098978	0.919	glutamatergic synapse
GO:0005829	0.915	cytosol
GO:0012505	0.910	endomembrane system
GO:0097060	0.670	synaptic membrane
GO:0043232	0.608	intracellular non-membrane-bounded organelle
GO:0098793	0.543	presynapse
GO:0005634	0.525	nucleus
GO:0005856	0.482	cytoskeleton
GO:0070013	0.427	intracellular organelle lumen
GO:0031981	0.420	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]