StarFunc result for job id O00292

User Input

>input (366 residues)
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQ
YVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQP
PEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00292	1.000	1.000	1.321E-75	366	1.000	1.000	O00292.pdb.gz	LFTY2_HUMAN Left-right determination factor 2 OS=Homo sapiens OX=9606 GN=LEFTY2 PE=1 SV=2
2	AFDB:P57785	0.946	0.941	1.875E-62	368	0.817	0.812	P57785.pdb.gz	LFTY2_MOUSE Left-right determination factor 2 OS=Mus musculus OX=10090 GN=Lefty2 PE=2 SV=2
3	AFDB:Q64280	0.933	0.928	7.867E-62	368	0.806	0.802	Q64280.pdb.gz	LFTY1_MOUSE Left-right determination factor 1 OS=Mus musculus OX=10090 GN=Lefty1 PE=2 SV=1
4	AFDB:A0A0B5JW28	0.782	0.790	1.817E-37	362	0.369	0.373	A0A0B5JW28.pdb.gz
5	AFDB:Q9PW55	0.769	0.784	8.172E-36	358	0.361	0.369	Q9PW55.pdb.gz	Q9PW55_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=xx:tdsubc_2b12 PE=1 SV=1
6	AFDB:Q9PVN4	0.463	0.467	1.419E-35	362	0.374	0.378	Q9PVN4.pdb.gz	Q9PVN4_CHICK Left-right determination factor OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:P07713	0.338	0.221	2.733E-16	588	0.216	0.134	P07713.pdb.gz	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
8	AFDB:P58166	0.315	0.328	4.021E-16	350	0.183	0.191	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
9	AFDB:Q90752	0.337	0.308	4.021E-16	405	0.224	0.202	Q90752.pdb.gz	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
10	AFDB:Q9VQG9	0.326	0.213	6.607E-16	586	0.186	0.116	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
11	PDB:5ntuA	0.310	0.360	1.240E-13	308	0.194	0.231	5ntuA.pdb.gz
12	PDB:5hlyA	0.316	0.379	2.152E-13	299	0.137	0.167	5hlyA.pdb.gz
13	PDB:5vqfB	0.273	0.305	5.497E-13	320	0.175	0.200	5vqfB.pdb.gz
14	PDB:5nxsA	0.284	0.348	1.657E-12	290	0.169	0.214	5nxsA.pdb.gz
15	PDB:5ffoG	0.291	0.347	2.307E-12	297	0.199	0.246	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
16	PDB:3rjrC	0.281	0.297	3.790E-12	343	0.189	0.201	3rjrC.pdb.gz
17	PDB:6umxA	0.278	0.354	4.062E-11	279	0.139	0.183	6umxA.pdb.gz
18	PDB:7y1rB	0.259	0.301	1.224E-10	308	0.194	0.231	7y1rB.pdb.gz
19	PDB:5nxsB	0.296	0.419	2.278E-9	251	0.153	0.223	5nxsB.pdb.gz
20	PDB:3m3rC	0.077	0.090	3.453E-3	293	0.077	0.096	3m3rC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00292	0.0	741	366	1.000	1.000	LFTY2_HUMAN Left-right determination factor 2 OS=Homo sapiens OX=9606 GN=LEFTY2 PE=1 SV=2
2	O75610	0.0	709	366	0.956	0.956	LFTY1_HUMAN Left-right determination factor 1 OS=Homo sapiens OX=9606 GN=LEFTY1 PE=2 SV=1
3	P57785	0.0	598	368	0.817	0.812	LFTY2_MOUSE Left-right determination factor 2 OS=Mus musculus OX=10090 GN=Lefty2 PE=2 SV=2
4	Q64280	0.0	584	368	0.806	0.802	LFTY1_MOUSE Left-right determination factor 1 OS=Mus musculus OX=10090 GN=Lefty1 PE=2 SV=1
5	Q9PVN4	3.13e-83	259	362	0.391	0.395	Q9PVN4_CHICK Left-right determination factor OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q9PW55	1.48e-80	252	358	0.355	0.363	Q9PW55_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=xx:tdsubc_2b12 PE=1 SV=1
7	Q9W6I7	2.96e-78	246	362	0.361	0.365	Q9W6I7_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=cb720 PE=2 SV=1
8	Q9PUK3	6.82e-74	234	320	0.344	0.394	Q9PUK3_CHICK LEFTY-1 protein (Fragment) OS=Gallus gallus OX=9031 GN=LEFTY-1 PE=2 SV=1
9	P21275	3.09e-12	69.7	408	0.169	0.152	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
10	Q90752	3.26e-12	69.3	405	0.180	0.163	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
11	Q06826	8.48e-12	68.2	408	0.169	0.152	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
12	A5HMF9	9.94e-12	68.2	404	0.178	0.161	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
13	Q8UVQ2	3.36e-11	66.2	391	0.180	0.169	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
14	O57574	4.22e-11	66.2	400	0.139	0.128	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
15	A5HMF8	1.97e-10	63.9	404	0.175	0.158	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
16	P12644	7.10e-10	62.4	408	0.164	0.147	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
17	E9QHW0	7.86e-10	62.0	379	0.197	0.190	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
18	P49001	4.71e-09	59.7	393	0.153	0.142	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
19	P21274	4.90e-09	59.7	394	0.153	0.142	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
20	Q4AEG6	6.98e-09	59.3	421	0.158	0.138	BMP10_RAT Bone morphogenetic protein 10 OS=Rattus norvegicus OX=10116 GN=Bmp10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	4.6e-07	41.3	TGF-beta propeptide
2	PF00019 TGF_beta	3e-06	39.4	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287139	0.956	Nodal homolog
2	9606.ENSP00000340361	0.916	Activin receptor type-2B
3	9606.ENSP00000296145	0.906	Teratocarcinoma-derived growth factor 1
4	9606.ENSP00000259216	0.891	Cryptic protein
5	9606.ENSP00000272134	0.872	Left-right determination factor 1
6	9606.ENSP00000304169	0.872	Pituitary homeobox 2
7	9606.ENSP00000238682	0.840	Transforming growth factor beta-3
8	9606.ENSP00000442656	0.834	Activin receptor type-1B
9	9606.ENSP00000221930	0.821	Transforming growth factor beta-1
10	9606.ENSP00000287538	0.791	Zinc finger protein ZIC 3
11	9606.ENSP00000243349	0.786	Activin receptor type-1C
12	9606.ENSP00000259915	0.783	POU domain, class 5, transcription factor 1
13	9606.ENSP00000241416	0.736	Activin receptor type-2A
14	9606.ENSP00000331745	0.722	Growth/differentiation factor 3
15	9606.ENSP00000366534	0.710	Forkhead box protein H1
16	9606.ENSP00000229307	0.690	Homeobox protein NANOG
17	9606.ENSP00000282561	0.655	Gap junction alpha-1 protein
18	9606.ENSP00000262160	0.650	Mothers against decapentaplegic homolog 2
19	9606.ENSP00000323588	0.645	Transcription factor SOX-2
20	9606.ENSP00000323155	0.633	DAN domain family member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.941	signaling receptor binding
GO:0098772	0.724	molecular function regulator activity
GO:0030545	0.518	signaling receptor regulator activity
GO:0048018	0.439	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.980	anatomical structure development
GO:0050896	0.967	response to stimulus
GO:0007275	0.967	multicellular organism development
GO:0071363	0.942	cellular response to growth factor stimulus
GO:0071559	0.928	response to transforming growth factor beta
GO:0048513	0.900	animal organ development
GO:0007178	0.892	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048731	0.860	system development
GO:0019222	0.834	regulation of metabolic process
GO:0060255	0.816	regulation of macromolecule metabolic process
GO:0031323	0.775	regulation of cellular metabolic process
GO:0080090	0.770	regulation of primary metabolic process
GO:0051171	0.770	regulation of nitrogen compound metabolic process
GO:0010468	0.769	regulation of gene expression
GO:0048519	0.737	negative regulation of biological process
GO:0048518	0.733	positive regulation of biological process
GO:0048523	0.680	negative regulation of cellular process
GO:0048522	0.666	positive regulation of cellular process
GO:0071560	0.634	cellular response to transforming growth factor beta stimulus
GO:0009889	0.623	regulation of biosynthetic process
GO:0019219	0.620	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.564	regulation of macromolecule biosynthetic process
GO:0051252	0.560	regulation of RNA metabolic process
GO:1903506	0.545	regulation of nucleic acid-templated transcription
GO:0006355	0.537	regulation of DNA-templated transcription
GO:0009653	0.520	anatomical structure morphogenesis
GO:0090092	0.515	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179	0.363	transforming growth factor beta receptor signaling pathway
GO:0042127	0.349	regulation of cell population proliferation
GO:0050793	0.329	regulation of developmental process
GO:0006357	0.325	regulation of transcription by RNA polymerase II
GO:0009790	0.321	embryo development
GO:0009888	0.318	tissue development
GO:0009893	0.312	positive regulation of metabolic process
GO:0030154	0.311	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0070013	0.972	intracellular organelle lumen
GO:0043227	0.826	membrane-bounded organelle
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0012505	0.688	endomembrane system
GO:0005737	0.568	cytoplasm
GO:0071944	0.505	cell periphery
GO:0005634	0.409	nucleus
GO:0031982	0.305	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]