StarFunc result for job id O00300

User Input

>input (401 residues)
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00300	1.000	1.000	3.622E-74	401	1.000	1.000	O00300.pdb.gz	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
2	AFDB:O08712	0.515	0.515	1.950E-64	401	0.850	0.850	O08712.pdb.gz	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
3	AFDB:O95407	0.384	0.499	2.173E-21	300	0.227	0.303	O95407.pdb.gz	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
4	AFDB:A5D8S6	0.376	0.244	5.500E-19	637	0.247	0.155	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
5	AFDB:A0A2R8QCA6	0.364	0.564	2.886E-17	241	0.180	0.299	A0A2R8QCA6.pdb.gz
6	AFDB:D3ZF92	0.382	0.241	3.786E-17	655	0.150	0.092	D3ZF92.pdb.gz	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
7	AFDB:O75509	0.379	0.240	1.183E-16	655	0.140	0.085	O75509.pdb.gz	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
8	AFDB:P25942	0.369	0.521	3.141E-16	277	0.140	0.202	P25942.pdb.gz	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
9	AFDB:Q4QQW2	0.363	0.492	6.713E-16	289	0.155	0.215	Q4QQW2.pdb.gz
10	AFDB:P20333	0.354	0.312	2.468E-15	461	0.170	0.148	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
11	PDB:7q3nU	0.127	0.148	2.401E-1	292	0.067	0.092	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:1c1zA	0.147	0.167	5.132E-1	326	0.082	0.101	1c1zA.pdb.gz
13	PDB:7qbgA	0.110	0.113	5.418E-1	381	0.070	0.073	7qbgA.pdb.gz	Generation of nanobodies targeting the human, transcobalamin-mediated vitamin B 12 uptake route.
14	PDB:3t5oA	0.111	0.061	7.502E-1	871	0.065	0.030	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
15	PDB:4b2tq	0.128	0.138	7.920E-1	359	0.077	0.086	4b2tq.pdb.gz
16	PDB:2bb5A	0.110	0.108	8.828E-1	409	0.070	0.068	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
17	PDB:7uwsG	0.097	0.098	1.097	382	0.085	0.089	7uwsG.pdb.gz	Atomic model of vesicular stomatitis virus and mechanism of assembly.
18	PDB:1ekuB	0.112	0.146	1.158	254	0.080	0.126	1ekuB.pdb.gz
19	PDB:1rj1A	0.112	0.221	1.158	148	0.055	0.149	1rj1A.pdb.gz
20	PDB:5l4kR	0.096	0.098	1.222	389	0.075	0.077	5l4kR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00300	0.0	835	401	1.000	1.000	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
2	O08712	0.0	719	401	0.850	0.850	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
3	O08727	0.0	726	401	0.863	0.863	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
4	O95407	1.81e-43	155	300	0.192	0.257	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
5	A5D8S6	3.95e-30	124	637	0.162	0.102	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
6	P25119	7.00e-29	119	474	0.160	0.135	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
7	P20333	2.12e-28	118	461	0.165	0.143	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
8	D3ZF92	1.06e-25	111	655	0.145	0.089	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
9	Q9EPU5	2.89e-24	107	655	0.145	0.089	TNR21_MOUSE Tumor necrosis factor receptor superfamily member 21 OS=Mus musculus OX=10090 GN=Tnfrsf21 PE=1 SV=2
10	O75509	1.58e-23	105	655	0.140	0.085	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
11	Q80WY6	7.42e-23	102	474	0.165	0.139	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
12	F6SVZ3	2.72e-22	97.4	269	0.150	0.223	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
13	P27512	7.39e-22	96.7	289	0.155	0.215	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
14	A0A8I6AHI1	8.49e-22	97.1	309	0.150	0.194	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
15	A0A8I6A4J5	1.13e-21	95.5	260	0.150	0.231	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
16	F1RAS9	2.30e-21	97.4	425	0.145	0.136	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
17	P25942	1.64e-19	89.7	277	0.140	0.202	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
18	O35305	9.51e-19	90.5	625	0.162	0.104	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
19	A0A8I5XVD8	6.76e-18	83.6	204	0.132	0.260	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
20	Q9Y6Q6	1.56e-17	86.7	616	0.140	0.091	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	7e-13	59.9	Death domain
2	PF00020 TNFR_c6	4.2e-25	99.2	TNFR/NGFR cysteine-rich region
3	PF10366 Vps39_1	1.5e+02	14.1	Vacuolar sorting protein 39 domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297350

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381775	0.999	Tumor necrosis factor ligand superfamily member 11
2	9606.ENSP00000357255	0.878	Osteocalcin
3	9606.ENSP00000468767	0.870	Tartrate-resistant acid phosphatase type 5
4	9606.ENSP00000282091	0.846	Parathyroid hormone
5	9606.ENSP00000360493	0.837	Runt-related transcription factor 2
6	9606.ENSP00000276431	0.827	Tumor necrosis factor receptor superfamily member 10B
7	9606.ENSP00000221132	0.823	Tumor necrosis factor receptor superfamily member 10A
8	9606.ENSP00000301691	0.823	Sclerostin
9	9606.ENSP00000241261	0.820	Tumor necrosis factor ligand superfamily member 10
10	9606.ENSP00000271651	0.787	Cathepsin K
11	9606.ENSP00000378517	0.776	Osteopontin
12	9606.ENSP00000261405	0.739	Von Willebrand factor
13	9606.ENSP00000443827	0.735	Transcription factor Sp7
14	9606.ENSP00000398698	0.732	Tumor necrosis factor
15	9606.ENSP00000368104	0.730	Bone morphogenetic protein 2
16	9606.ENSP00000385675	0.730	Interleukin-6
17	9606.ENSP00000363081	0.710	Dickkopf-related protein 1
18	9606.ENSP00000393887	0.696	Alpha-2-HS-glycoprotein
19	9606.ENSP00000228938	0.690	Matrix Gla protein
20	9606.ENSP00000441765	0.687	Parathyroid hormone-related protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.997	signaling receptor activity
GO:0005102	0.987	signaling receptor binding
GO:0098772	0.960	molecular function regulator activity
GO:0140677	0.939	molecular function activator activity
GO:0030545	0.939	signaling receptor regulator activity
GO:0048018	0.921	receptor ligand activity
GO:0005125	0.790	cytokine activity
GO:0019899	0.496	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0032501	0.973	multicellular organismal process
GO:0032502	0.959	developmental process
GO:0048856	0.952	anatomical structure development
GO:0051716	0.909	cellular response to stimulus
GO:0048519	0.888	negative regulation of biological process
GO:0007275	0.860	multicellular organism development
GO:0001501	0.821	skeletal system development
GO:0007154	0.785	cell communication
GO:0023052	0.776	signaling
GO:0007165	0.765	signal transduction
GO:0048518	0.742	positive regulation of biological process
GO:0048522	0.659	positive regulation of cellular process
GO:0051239	0.627	regulation of multicellular organismal process
GO:0050793	0.625	regulation of developmental process
GO:0048523	0.624	negative regulation of cellular process
GO:0019222	0.599	regulation of metabolic process
GO:0042221	0.432	response to chemical
GO:0060255	0.413	regulation of macromolecule metabolic process
GO:0048583	0.406	regulation of response to stimulus
GO:0010033	0.392	response to organic substance
GO:0051241	0.366	negative regulation of multicellular organismal process
GO:0045595	0.362	regulation of cell differentiation
GO:0051171	0.355	regulation of nitrogen compound metabolic process
GO:0007166	0.352	cell surface receptor signaling pathway
GO:0010604	0.350	positive regulation of macromolecule metabolic process
GO:0080090	0.349	regulation of primary metabolic process
GO:0023051	0.348	regulation of signaling
GO:0010646	0.348	regulation of cell communication
GO:0010468	0.343	regulation of gene expression
GO:0022603	0.324	regulation of anatomical structure morphogenesis
GO:0071840	0.321	cellular component organization or biogenesis
GO:0051093	0.320	negative regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0005615	1.000	extracellular space
GO:0005886	0.985	plasma membrane
GO:0032991	0.954	protein-containing complex
GO:0043227	0.731	membrane-bounded organelle
GO:0005622	0.585	intracellular anatomical structure
GO:0005737	0.529	cytoplasm
GO:0043235	0.510	receptor complex
GO:0043231	0.416	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]