StarFunc result for job id O00305

User Input

>input (520 residues)
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPS
DSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISF
DAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNS
SSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQK
ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQ
LVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQH
SRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00305	1.000	1.000	9.273E-91	520	1.000	1.000	O00305.pdb.gz	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
2	AFDB:B0F0D0	0.640	0.642	2.666E-78	519	0.873	0.875	B0F0D0.pdb.gz	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
3	AFDB:Q02641	0.650	0.569	1.411E-63	598	0.619	0.538	Q02641.pdb.gz	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
4	AFDB:Q08289	0.614	0.486	2.137E-63	660	0.658	0.518	Q08289.pdb.gz	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
5	AFDB:Q2Q551	0.626	0.542	3.935E-61	603	0.612	0.527	Q2Q551.pdb.gz	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
6	AFDB:P54284	0.664	0.711	1.538E-60	484	0.631	0.678	P54284.pdb.gz	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
7	AFDB:B2XY77	0.650	0.569	1.154E-59	599	0.569	0.494	B2XY77.pdb.gz
8	AFDB:B2XY76	0.625	0.513	5.718E-59	637	0.571	0.466	B2XY76.pdb.gz
9	AFDB:P19517	0.627	0.622	4.873E-57	524	0.594	0.590	P19517.pdb.gz	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
10	AFDB:M9PD84	0.631	0.401	7.580E-54	844	0.512	0.315	M9PD84.pdb.gz	M9PD84_DROME Ca2+-channel-protein-beta-subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Ca-beta PE=3 SV=1
11	PDB:7mixC	0.543	0.861	2.012E-42	324	0.502	0.806	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
12	PDB:6jpaC	0.339	0.980	1.254E-22	178	0.304	0.888	6jpaC.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
13	PDB:2xkxA	0.216	0.164	5.459E-10	721	0.129	0.093	2xkxA.pdb.gz
14	PDB:6nuiA	0.254	0.583	1.964E-5	198	0.079	0.207	6nuiA.pdb.gz
15	PDB:4f4jA	0.242	0.601	3.156E-5	189	0.062	0.169	4f4jA.pdb.gz
16	PDB:1lvgA	0.232	0.564	1.234E-4	190	0.079	0.216	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
17	PDB:1z8fA	0.233	0.573	1.761E-4	184	0.063	0.179	1z8fA.pdb.gz
18	PDB:2yhsA	0.168	0.252	3.839E-3	308	0.054	0.091	2yhsA.pdb.gz
19	PDB:2c95A	0.213	0.480	4.073E-3	195	0.040	0.108	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
20	PDB:3qwyA	0.098	0.285	5.163E-3	170	0.029	0.088	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2SZ54	602	598	0.565	0.492	A2SZ54_DANRE Voltage-dependent L-type calcium channel subunit beta-2 OS=Danio rerio OX=7955 GN=cacnb2b PE=2 SV=1
2	A8WHZ5	823	485	0.810	0.868	A8WHZ5_DANRE Voltage-dependent L-type calcium channel subunit beta-3 OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
3	B0F0C6	746	489	0.758	0.806	B0F0C6_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
4	B0F0D0	886	519	0.873	0.875	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
5	B0F0D1	806	523	0.819	0.815	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
6	D4A055	1061	519	0.985	0.987	CACB4_RAT Voltage-dependent L-type calcium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Cacnb4 PE=1 SV=2
7	O00305	1075	520	1.000	1.000	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
8	P19517	580	524	0.598	0.594	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
9	P54283	619	597	0.606	0.528	CACB1_RAT Voltage-dependent L-type calcium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Cacnb1 PE=1 SV=1
10	P54284	624	484	0.637	0.684	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
11	P54285	625	484	0.638	0.686	CACB3_MOUSE Voltage-dependent L-type calcium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Cacnb3 PE=1 SV=2
12	P54287	621	484	0.633	0.680	CACB3_RAT Voltage-dependent L-type calcium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Cacnb3 PE=1 SV=1
13	P54288	620	632	0.663	0.546	CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 OS=Oryctolagus cuniculus OX=9986 GN=CACNB2 PE=1 SV=1
14	Q02641	611	598	0.613	0.533	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
15	Q08289	616	660	0.648	0.511	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
16	Q2Q551	582	603	0.587	0.506	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
17	Q6DG31	583	478	0.585	0.636	Q6DG31_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
18	Q8CC27	607	655	0.646	0.513	CACB2_MOUSE Voltage-dependent L-type calcium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Cacnb2 PE=1 SV=1
19	Q8R0S4	1059	519	0.983	0.985	CACB4_MOUSE Voltage-dependent L-type calcium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Cacnb4 PE=1 SV=2
20	Q8R3Z5	612	597	0.608	0.529	CACB1_MOUSE Voltage-dependent L-type calcium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Cacnb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00625 Guanylate_kin	1.4e-43	160.2	Guanylate kinase
2	PF00018 SH3_1	6.1	17.9	SH3 domain
3	PF07653 SH3_2	4.5e+02	12.1	Variant SH3 domain
4	PF14604 SH3_9	5.1e+02	12.0	Variant SH3 domain
5	PF12052 VGCC_beta4Aa_N	2.1e-19	80.6	Voltage gated calcium channel subunit beta domain 4Aa N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438949

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353362	0.987	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
2	9606.ENSP00000349320	0.983	Voltage-dependent calcium channel subunit alpha-2/delta-1
3	9606.ENSP00000372169	0.982	Voltage-dependent calcium channel subunit alpha-2/delta-4
4	9606.ENSP00000266376	0.969	Voltage-dependent L-type calcium channel subunit alpha-1C
5	9606.ENSP00000355192	0.968	Voltage-dependent L-type calcium channel subunit alpha-1S
6	9606.ENSP00000365441	0.966	Voltage-dependent L-type calcium channel subunit alpha-1F
7	9606.ENSP00000288139	0.965	Voltage-dependent L-type calcium channel subunit alpha-1D
8	9606.ENSP00000418081	0.961	Voltage-dependent calcium channel subunit alpha-2/delta-2
9	9606.ENSP00000270458	0.948	Voltage-dependent calcium channel gamma-8 subunit
10	9606.ENSP00000005284	0.947	Voltage-dependent calcium channel gamma-3 subunit
11	9606.ENSP00000301050	0.945	Voltage-dependent L-type calcium channel subunit beta-3
12	9606.ENSP00000356545	0.944	Voltage-dependent R-type calcium channel subunit alpha-1E
13	9606.ENSP00000262138	0.941	Voltage-dependent calcium channel gamma-4 subunit
14	9606.ENSP00000360423	0.919	Voltage-dependent N-type calcium channel subunit alpha-1B
15	9606.ENSP00000375647	0.918	Voltage-dependent calcium channel gamma-7 subunit
16	9606.ENSP00000252729	0.910	Voltage-dependent calcium channel gamma-6 subunit
17	9606.ENSP00000334198	0.909	Voltage-dependent T-type calcium channel subunit alpha-1H
18	9606.ENSP00000300105	0.906	Voltage-dependent calcium channel gamma-2 subunit
19	9606.ENSP00000226021	0.895	Voltage-dependent calcium channel gamma-1 subunit
20	9606.ENSP00000419101	0.891	Voltage-dependent calcium channel subunit alpha-2/delta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0008331	0.878	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.985	regulation of biological process
GO:0050794	0.954	regulation of cellular process
GO:0032879	0.897	regulation of localization
GO:0009987	0.868	cellular process
GO:0034762	0.755	regulation of transmembrane transport
GO:0010959	0.748	regulation of metal ion transport
GO:0032501	0.711	multicellular organismal process
GO:0051924	0.658	regulation of calcium ion transport
GO:0034765	0.620	regulation of monoatomic ion transmembrane transport
GO:1904062	0.599	regulation of monoatomic cation transmembrane transport
GO:0032412	0.582	regulation of monoatomic ion transmembrane transporter activity
GO:1903169	0.556	regulation of calcium ion transmembrane transport
GO:0051179	0.549	localization
GO:0006810	0.541	transport
GO:0050896	0.476	response to stimulus
GO:0006811	0.464	monoatomic ion transport
GO:1901019	0.435	regulation of calcium ion transmembrane transporter activity
GO:0030001	0.392	metal ion transport
GO:0007154	0.390	cell communication
GO:0023052	0.342	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005891	0.996	voltage-gated calcium channel complex
GO:0030054	0.925	cell junction
GO:0043226	0.814	organelle
GO:0005622	0.799	intracellular anatomical structure
GO:0045202	0.780	synapse
GO:0043227	0.775	membrane-bounded organelle
GO:0043229	0.731	intracellular organelle
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005737	0.601	cytoplasm
GO:0031974	0.465	membrane-enclosed lumen
GO:0005634	0.450	nucleus
GO:0070013	0.433	intracellular organelle lumen
GO:0031981	0.417	nuclear lumen
GO:0012505	0.325	endomembrane system
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]