StarFunc result for job id O00308

User Input

>input (870 residues)
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLT
LNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQ
PPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPT
TATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPD
ALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQR
PTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV
YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
SGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDL
RRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPD
HLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKE
NNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQ
TKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFW
QVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN
RLDLPPYKSYEQLREKLLYAIEETEGFGQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00308	1.000	1.000	0.000	870	1.000	1.000	O00308.pdb.gz	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
2	AFDB:Q9H0M0	0.577	0.546	0.000	922	0.628	0.592	Q9H0M0.pdb.gz	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
3	AFDB:Q96J02	0.541	0.522	2.049E-100	903	0.582	0.560	Q96J02.pdb.gz	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
4	AFDB:U6C7R6	0.541	0.543	1.988E-99	867	0.576	0.578	U6C7R6.pdb.gz	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
5	AFDB:K7WBL1	0.532	0.541	3.464E-99	856	0.572	0.582	K7WBL1.pdb.gz	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
6	AFDB:Q9Y0H4	0.683	0.630	2.532E-97	949	0.552	0.506	Q9Y0H4.pdb.gz	SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1
7	AFDB:A0A590UJW8	0.528	0.553	6.607E-97	830	0.551	0.577	A0A590UJW8.pdb.gz	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
8	AFDB:A0A590UK44	0.446	0.496	5.710E-79	779	0.492	0.549	A0A590UK44.pdb.gz	A0A590UK44_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
9	AFDB:Q9CUN6	0.300	0.355	1.834E-60	731	0.331	0.394	Q9CUN6.pdb.gz	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
10	AFDB:A0A0G2K612	0.318	0.374	2.244E-60	731	0.326	0.389	A0A0G2K612.pdb.gz	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
11	PDB:7jq9A	0.403	0.146	6.267E-33	2427	0.174	0.062	7jq9A.pdb.gz
12	PDB:7mopA	0.394	0.142	3.488E-32	2445	0.175	0.062	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:1cjyA	0.120	0.161	9.045E-7	633	0.025	0.035	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:4rj9A	0.120	0.575	1.164E-6	161	0.030	0.161	4rj9A.pdb.gz
15	PDB:5a50A	0.118	0.549	1.288E-6	165	0.029	0.152	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5iz5B	0.126	0.146	2.134E-6	746	0.025	0.029	5iz5B.pdb.gz
17	PDB:5ixcA	0.117	0.148	2.245E-6	684	0.026	0.034	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:5iz5A	0.118	0.134	6.480E-6	757	0.025	0.029	5iz5A.pdb.gz
19	PDB:5a52A	0.122	0.583	8.341E-6	154	0.026	0.149	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:7lq1A	0.127	0.117	1.129E-5	950	0.018	0.017	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJQ1	0.0	966	900	0.575	0.556	A0A590UJQ1_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
2	A0A590UJW8	0.0	927	830	0.564	0.592	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
3	A2VCZ7	0.0	1319	866	0.759	0.762	A2VCZ7_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
4	F6P346	0.0	1321	867	0.757	0.760	F6P346_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=id:ibd1121 PE=1 SV=1
5	K7WBL1	0.0	962	856	0.570	0.579	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
6	O00308	0.0	1818	870	1.000	1.000	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
7	P39940	0.0	544	809	0.322	0.346	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
8	Q8BZZ3	0.0	1078	918	0.636	0.602	WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus OX=10090 GN=Wwp1 PE=1 SV=2
9	Q8C863	0.0	972	864	0.585	0.589	ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus OX=10090 GN=Itch PE=1 SV=2
10	Q92462	0.0	546	767	0.332	0.377	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
11	Q96J02	0.0	972	903	0.590	0.568	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
12	Q9DBH0	0.0	1754	870	0.960	0.960	WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus OX=10090 GN=Wwp2 PE=1 SV=1
13	Q9H0M0	0.0	1055	922	0.631	0.595	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
14	Q9N2Z7	0.0	833	794	0.447	0.490	WWP1_CAEEL E3 ubiquitin-protein ligase wwp-1 OS=Caenorhabditis elegans OX=6239 GN=wwp-1 PE=1 SV=2
15	Q9Y0H4	0.0	920	949	0.561	0.514	SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1
16	U6C7R6	0.0	962	867	0.574	0.576	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
17	Q5BDP1	5.32e-175	528	821	0.317	0.336	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
18	O14326	1.10e-170	516	786	0.306	0.338	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
19	P46934	1.43e-167	523	1319	0.313	0.206	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
20	A2A5Z6	5.44e-166	503	748	0.313	0.364	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	3.4e-91	317.5	HECT-domain (ubiquitin-transferase)
2	PF00397 WW	4.5e-45	162.7	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352069

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361021	0.998	Phosphatase and tensin homolog
2	9606.ENSP00000441543	0.990	Polyubiquitin-C
3	9606.ENSP00000272317	0.981	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000400906	0.963	Ubiquitin-conjugating enzyme E2L 3
5	9606.ENSP00000304697	0.943	Polyubiquitin-B
6	9606.ENSP00000388107	0.940	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000349722	0.927	Ubiquitin conjugating enzyme E2 D3
8	9606.ENSP00000253814	0.923	NEDD4 family-interacting protein 1
9	9606.ENSP00000360475	0.916	Arrestin domain-containing protein 1
10	9606.ENSP00000467579	0.910	WW domain-binding protein 2
11	9606.ENSP00000262158	0.905	Mothers against decapentaplegic homolog 7
12	9606.ENSP00000259915	0.902	POU domain, class 5, transcription factor 1
13	9606.ENSP00000265138	0.891	Arrestin domain-containing protein 3
14	9606.ENSP00000005340	0.870	Segment polarity protein dishevelled homolog DVL-2
15	9606.ENSP00000381717	0.861	Ubiquitin-conjugating enzyme E2 D2
16	9606.ENSP00000263388	0.853	Neurogenic locus notch homolog protein 3
17	9606.ENSP00000480798	0.837	NEDD4 family-interacting protein 2
18	9606.ENSP00000480158	0.806	DNA-directed RNA polymerase II subunit RPB1
19	9606.ENSP00000245479	0.802	Transcription factor SOX-9
20	9606.ENSP00000332973	0.802	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0061629	0.992	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0043170	0.980	macromolecule metabolic process
GO:0019222	0.972	regulation of metabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0044237	0.929	cellular metabolic process
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:1901564	0.916	organonitrogen compound metabolic process
GO:0019538	0.901	protein metabolic process
GO:0051171	0.875	regulation of nitrogen compound metabolic process
GO:0043412	0.875	macromolecule modification
GO:0070647	0.866	protein modification by small protein conjugation or removal
GO:0032446	0.831	protein modification by small protein conjugation
GO:0006508	0.775	proteolysis
GO:0016567	0.756	protein ubiquitination
GO:0048519	0.715	negative regulation of biological process
GO:0044265	0.715	cellular macromolecule catabolic process
GO:0048523	0.694	negative regulation of cellular process
GO:0006511	0.684	ubiquitin-dependent protein catabolic process
GO:0010468	0.616	regulation of gene expression
GO:0048518	0.585	positive regulation of biological process
GO:0031323	0.505	regulation of cellular metabolic process
GO:0019219	0.473	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.463	regulation of biosynthetic process
GO:0048522	0.458	positive regulation of cellular process
GO:0010556	0.444	regulation of macromolecule biosynthetic process
GO:0031326	0.438	regulation of cellular biosynthetic process
GO:0051252	0.425	regulation of RNA metabolic process
GO:0010604	0.423	positive regulation of macromolecule metabolic process
GO:0048583	0.418	regulation of response to stimulus
GO:0065009	0.415	regulation of molecular function
GO:0050896	0.374	response to stimulus
GO:0010605	0.366	negative regulation of macromolecule metabolic process
GO:0051173	0.361	positive regulation of nitrogen compound metabolic process
GO:0010646	0.328	regulation of cell communication
GO:0031324	0.315	negative regulation of cellular metabolic process
GO:0051172	0.314	negative regulation of nitrogen compound metabolic process
GO:0023051	0.312	regulation of signaling
GO:0006355	0.306	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0032991	0.981	protein-containing complex
GO:0005829	0.981	cytosol
GO:0005654	0.956	nucleoplasm
GO:0005576	0.943	extracellular region
GO:0031982	0.933	vesicle
GO:0016020	0.908	membrane
GO:0005615	0.892	extracellular space
GO:1903561	0.852	extracellular vesicle
GO:0070062	0.834	extracellular exosome
GO:1902494	0.685	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]