StarFunc result for job id O00311

User Input

>input (574 residues)
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MTU6	0.720	0.720	4.808E-85	574	1.000	1.000	A0A384MTU6.pdb.gz	A0A384MTU6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q9PWM7	0.624	0.740	1.227E-54	483	0.540	0.642	Q9PWM7.pdb.gz	Q9PWM7_XENLA Cell division cycle 7 L homeolog OS=Xenopus laevis OX=8355 GN=cdc7.L PE=2 SV=1
3	AFDB:Q9W3Y1	0.562	0.463	1.971E-35	700	0.314	0.257	Q9W3Y1.pdb.gz	Q9W3Y1_DROME Cdc7 kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc7 PE=4 SV=2
4	AFDB:Q9VJ90	0.525	0.456	4.802E-28	665	0.308	0.266	Q9VJ90.pdb.gz	Q9VJ90_DROME FI19424p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5790 PE=2 SV=1
5	AFDB:C8VHB6	0.515	0.599	4.392E-23	492	0.233	0.272	C8VHB6.pdb.gz	C8VHB6_EMENI Serine/threonine protein kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03450 PE=4 SV=1
6	AFDB:Q9UQY9	0.506	0.673	6.936E-23	429	0.207	0.277	Q9UQY9.pdb.gz	SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo4 PE=1 SV=1
7	AFDB:A0A1D8PHD2	0.494	0.435	9.406E-23	656	0.223	0.195	A0A1D8PHD2.pdb.gz	A0A1D8PHD2_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC7 PE=4 SV=1
8	AFDB:P06243	0.507	0.572	2.119E-22	507	0.242	0.274	P06243.pdb.gz	CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC7 PE=1 SV=2
9	AFDB:P50582	0.518	0.585	5.561E-22	507	0.228	0.258	P50582.pdb.gz	HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsk1 PE=1 SV=1
10	PDB:7pt68	0.512	0.722	4.040E-19	402	0.232	0.331	7pt68.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
11	PDB:7p5z1	0.426	0.709	3.586E-18	336	0.207	0.354	7p5z1.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
12	PDB:5oniA	0.426	0.720	5.647E-15	334	0.138	0.237	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
13	PDB:4krcA	0.439	0.826	1.272E-14	297	0.138	0.266	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	PDB:1unlA	0.430	0.814	7.915E-14	292	0.146	0.288	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:5xvuA	0.452	0.790	2.185E-13	321	0.124	0.221	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.
16	PDB:3e3bX	0.471	0.795	2.677E-13	334	0.146	0.251	3e3bX.pdb.gz	Structure of human protein kinase CK2alpha2 with a potent indazole-derivative inhibitor
17	PDB:4fi1A	0.448	0.682	2.816E-13	371	0.134	0.208	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP
18	PDB:4yc3A	0.431	0.809	5.179E-13	295	0.124	0.241	4yc3A.pdb.gz
19	PDB:7opmA	0.401	0.623	3.062E-12	362	0.150	0.238	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
20	AFDB:P20794	0.415	0.384	1.443E-9	623	0.143	0.132	P20794.pdb.gz	MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens OX=9606 GN=MAK PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MTU6	0.0	1197	574	1.000	1.000	A0A384MTU6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	O00311	0.0	1197	574	1.000	1.000	CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens OX=9606 GN=CDC7 PE=1 SV=1
3	Q9PWM7	0.0	612	483	0.551	0.654	Q9PWM7_XENLA Cell division cycle 7 L homeolog OS=Xenopus laevis OX=8355 GN=cdc7.L PE=2 SV=1
4	B1AMW7	1.68e-110	328	157	0.274	1.000	B1AMW7_HUMAN Cell division cycle 7 (Fragment) OS=Homo sapiens OX=9606 GN=CDC7 PE=1 SV=1
5	Q9VJ90	9.28e-90	292	665	0.336	0.290	Q9VJ90_DROME FI19424p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5790 PE=2 SV=1
6	Q8T0Q5	3.78e-85	276	519	0.321	0.355	Q8T0Q5_DROME GH13884p OS=Drosophila melanogaster OX=7227 GN=CG5790 PE=2 SV=1
7	Q9W3Y1	9.05e-44	168	700	0.131	0.107	Q9W3Y1_DROME Cdc7 kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc7 PE=4 SV=2
8	Q0WPK0	1.83e-33	138	889	0.230	0.148	Q0WPK0_ARATH Kinase like protein OS=Arabidopsis thaliana OX=3702 GN=DL4515C PE=1 SV=1
9	P06243	4.87e-30	125	507	0.118	0.134	CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC7 PE=1 SV=2
10	P50582	1.47e-24	109	507	0.113	0.128	HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsk1 PE=1 SV=1
11	A0A1D8PHD2	3.24e-24	109	656	0.115	0.101	A0A1D8PHD2_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC7 PE=4 SV=1
12	C8VHB6	6.30e-24	107	492	0.113	0.132	C8VHB6_EMENI Serine/threonine protein kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03450 PE=4 SV=1
13	Q9UQY9	7.00e-22	100	429	0.110	0.147	SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo4 PE=1 SV=1
14	A8BPA7	2.53e-15	82.0	1697	0.080	0.027	A8BPA7_GIAIC Kinase, CDC7 OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) OX=184922 GN=GL50803_00112076 PE=4 SV=1
15	Q9CAI5	7.43e-13	73.2	465	0.089	0.110	CKL2_ARATH Casein kinase 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=CKL2 PE=1 SV=1
16	Q54P47	2.29e-12	72.8	1335	0.117	0.050	NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum OX=44689 GN=ndrC PE=3 SV=1
17	P43565	2.85e-12	72.4	1770	0.155	0.050	RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM15 PE=1 SV=1
18	Q5A3P6	7.18e-12	70.9	947	0.085	0.052	PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PKH2 PE=1 SV=2
19	Q9ZUP4	1.32e-11	68.9	433	0.085	0.113	CKL5_ARATH Casein kinase 1-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=CKL5 PE=1 SV=1
20	P42158	1.36e-11	69.3	450	0.085	0.109	CKL1_ARATH Casein kinase 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=CKL1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.99	20.0	ABC1 atypical kinase-like domain
2	PF01636 APH	77	14.6	Phosphotransferase enzyme family
3	PF00069 Pkinase	1.8e-44	163.7	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.4e-12	59.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
2	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
3	9606.ENSP00000265728	0.999	Protein DBF4 homolog A
4	9606.ENSP00000216122	0.998	DNA replication licensing factor MCM5
5	9606.ENSP00000264156	0.998	DNA replication licensing factor MCM6
6	9606.ENSP00000323663	0.995	Protein DBF4 homolog B
7	9606.ENSP00000418268	0.995	Protein MCM10 homolog
8	9606.ENSP00000307288	0.994	DNA replication licensing factor MCM7
9	9606.ENSP00000405726	0.992	Cell division control protein 45 homolog
10	9606.ENSP00000480987	0.991	DNA replication licensing factor MCM3
11	9606.ENSP00000219097	0.983	Origin recognition complex subunit 6
12	9606.ENSP00000372023	0.983	Serine/threonine-protein kinase Chk2
13	9606.ENSP00000209728	0.980	Cell division control protein 6 homolog
14	9606.ENSP00000301019	0.980	DNA replication factor Cdt1
15	9606.ENSP00000343741	0.980	Serine/threonine-protein kinase ATR
16	9606.ENSP00000297431	0.976	Origin recognition complex subunit 5
17	9606.ENSP00000388648	0.975	Serine/threonine-protein kinase Chk1
18	9606.ENSP00000360623	0.973	Origin recognition complex subunit 1
19	9606.ENSP00000266970	0.972	Cyclin-dependent kinase 2
20	9606.ENSP00000350491	0.965	DNA primase small subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:1901363	0.350	heterocyclic compound binding
GO:0097159	0.349	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0019222	0.970	regulation of metabolic process
GO:1901990	0.969	regulation of mitotic cell cycle phase transition
GO:0090068	0.966	positive regulation of cell cycle process
GO:0045931	0.957	positive regulation of mitotic cell cycle
GO:1901989	0.957	positive regulation of cell cycle phase transition
GO:0080090	0.955	regulation of primary metabolic process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:1901992	0.953	positive regulation of mitotic cell cycle phase transition
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0044772	0.948	mitotic cell cycle phase transition
GO:0051054	0.944	positive regulation of DNA metabolic process
GO:0006275	0.942	regulation of DNA replication
GO:1902749	0.925	regulation of cell cycle G2/M phase transition
GO:0044843	0.910	cell cycle G1/S phase transition
GO:0010389	0.883	regulation of G2/M transition of mitotic cell cycle
GO:0000082	0.880	G1/S transition of mitotic cell cycle
GO:0090329	0.868	regulation of DNA-templated DNA replication
GO:0045740	0.854	positive regulation of DNA replication
GO:0008152	0.726	metabolic process
GO:0071704	0.723	organic substance metabolic process
GO:0044238	0.717	primary metabolic process
GO:0006807	0.704	nitrogen compound metabolic process
GO:2000105	0.702	positive regulation of DNA-templated DNA replication
GO:0042127	0.698	regulation of cell population proliferation
GO:1902751	0.646	positive regulation of cell cycle G2/M phase transition
GO:0044237	0.607	cellular metabolic process
GO:0043170	0.577	macromolecule metabolic process
GO:0008284	0.384	positive regulation of cell population proliferation
GO:0050896	0.342	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0015630	0.999	microtubule cytoskeleton
GO:0045171	0.990	intercellular bridge
GO:0005737	0.987	cytoplasm
GO:0072686	0.987	mitotic spindle
GO:0032991	0.350	protein-containing complex
GO:0005829	0.310	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]