StarFunc result for job id O00327

User Input

>input (626 residues)
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9I8T7	0.728	0.721	1.338E-97	633	0.942	0.932	Q9I8T7.pdb.gz	BMAL1_CHICK Basic helix-loop-helix ARNT-like protein 1 OS=Gallus gallus OX=9031 GN=BMAL1 PE=1 SV=1
2	AFDB:Q7ZU37	0.686	0.686	4.980E-90	626	0.855	0.855	Q7ZU37.pdb.gz
3	AFDB:A4IG25	0.703	0.683	1.645E-88	645	0.845	0.820	A4IG25.pdb.gz
4	AFDB:Q8WYA1	0.622	0.613	8.662E-64	636	0.495	0.487	Q8WYA1.pdb.gz	BMAL2_HUMAN Basic helix-loop-helix ARNT-like protein 2 OS=Homo sapiens OX=9606 GN=BMAL2 PE=1 SV=2
5	AFDB:Q2VPD4	0.247	0.266	4.169E-53	579	0.433	0.468	Q2VPD4.pdb.gz	BMAL2_MOUSE Basic helix-loop-helix ARNT-like protein 2 OS=Mus musculus OX=10090 GN=Bmal2 PE=1 SV=2
6	AFDB:Q6NZ12	0.471	0.575	1.535E-46	500	0.395	0.494	Q6NZ12.pdb.gz
7	AFDB:P41739	0.238	0.190	1.792E-42	800	0.319	0.250	P41739.pdb.gz	ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus OX=10116 GN=Arnt PE=1 SV=2
8	AFDB:E7FDK6	0.248	0.216	3.333E-42	731	0.326	0.279	E7FDK6.pdb.gz
9	AFDB:P79832	0.243	0.214	8.221E-42	723	0.323	0.279	P79832.pdb.gz	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
10	AFDB:Q9DG12	0.245	0.211	1.445E-41	737	0.327	0.278	Q9DG12.pdb.gz	ARNT2_DANRE Aryl hydrocarbon receptor nuclear translocator 2 OS=Danio rerio OX=7955 GN=arnt2 PE=1 SV=2
11	PDB:2wkpA	0.145	0.266	5.608E-4	320	0.029	0.056	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
12	PDB:7rzwB	0.157	0.116	2.572E-3	864	0.024	0.017	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
13	PDB:6umzA	0.143	0.618	5.667E-3	127	0.021	0.102	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
14	PDB:6jt0B	0.117	0.126	2.750E-2	576	0.034	0.036	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:7db7B	0.083	0.069	3.446E-2	836	0.050	0.037	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
16	PDB:5y58B	0.088	0.095	1.335E-1	568	0.075	0.083	5y58B.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
17	PDB:5a1uE	0.074	0.060	1.872E-1	824	0.032	0.024	5a1uE.pdb.gz
18	PDB:7bwnJ	0.046	0.082	2.483E-1	280	0.026	0.057	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
19	PDB:7mkuA	0.051	0.082	3.685E-1	302	0.027	0.056	7mkuA.pdb.gz
20	PDB:7nfcC	0.078	0.096	4.886E-1	477	0.059	0.078	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IH97	0.0	653	631	0.550	0.545	A0A0R4IH97_DANRE Aryl hydrocarbon receptor nuclear translocator-like 2 OS=Danio rerio OX=7955 GN=bmal2 PE=4 SV=1
2	A0A140VKD3	0.0	1293	625	0.998	1.000	A0A140VKD3_HUMAN Testis tissue sperm-binding protein Li 50e OS=Homo sapiens OX=9606 PE=2 SV=1
3	A0A669KBF4	0.0	1286	630	0.998	0.992	A0A669KBF4_HUMAN Basic helix-loop-helix ARNT like 1 OS=Homo sapiens OX=9606 GN=BMAL1 PE=1 SV=1
4	H0Y5R1	0.0	569	588	0.495	0.527	H0Y5R1_HUMAN Basic helix-loop-helix ARNT like 2 (Fragment) OS=Homo sapiens OX=9606 GN=BMAL2 PE=1 SV=1
5	O00327	0.0	1299	626	1.000	1.000	BMAL1_HUMAN Basic helix-loop-helix ARNT-like protein 1 OS=Homo sapiens OX=9606 GN=BMAL1 PE=1 SV=2
6	Q8JIG1	0.0	1050	622	0.843	0.849	Q8JIG1_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1b OS=Danio rerio OX=7955 GN=bmal1b PE=2 SV=1
7	Q8WYA1	0.0	577	636	0.506	0.498	BMAL2_HUMAN Basic helix-loop-helix ARNT-like protein 2 OS=Homo sapiens OX=9606 GN=BMAL2 PE=1 SV=2
8	Q9EPW1	0.0	1278	626	0.982	0.982	BMAL1_RAT Basic helix-loop-helix ARNT-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bmal1 PE=2 SV=4
9	Q9I879	0.0	1076	626	0.858	0.858	Q9I879_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1a OS=Danio rerio OX=7955 GN=bmal1a PE=1 SV=1
10	Q9I8T7	0.0	1195	633	0.942	0.932	BMAL1_CHICK Basic helix-loop-helix ARNT-like protein 1 OS=Gallus gallus OX=9031 GN=BMAL1 PE=1 SV=1
11	Q9IAU1	0.0	645	575	0.532	0.579	Q9IAU1_DANRE Bmal2 OS=Danio rerio OX=7955 GN=bmal2 PE=2 SV=1
12	Q9WTL8	0.0	1267	632	0.982	0.973	BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 OS=Mus musculus OX=10090 GN=Bmal1 PE=1 SV=2
13	Q2VPD4	1.29e-165	487	579	0.438	0.473	BMAL2_MOUSE Basic helix-loop-helix ARNT-like protein 2 OS=Mus musculus OX=10090 GN=Bmal2 PE=1 SV=2
14	O61734	1.77e-143	424	413	0.335	0.508	CYCL_DROME Protein cycle OS=Drosophila melanogaster OX=7227 GN=cyc PE=1 SV=2
15	Q1JPT1	3.03e-110	340	440	0.296	0.420	Q1JPT1_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
16	Q64FF9	1.10e-109	341	503	0.296	0.368	Q64FF9_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
17	O15945	3.12e-107	339	642	0.265	0.259	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
18	Q9BE97	1.92e-106	341	790	0.264	0.209	ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=1 SV=1
19	P27540	2.13e-106	341	789	0.265	0.210	ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=1 SV=1
20	P53762	6.46e-106	340	791	0.278	0.220	ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator OS=Mus musculus OX=10090 GN=Arnt PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2.4e-13	61.2	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	2.1e-17	74.6	PAS fold
3	PF14598 PAS_11	5.1e-24	95.9	PAS domain
4	PF08446 PAS_2	87	15.2	PAS fold
5	PF08447 PAS_3	2.2e-16	71.2	PAS fold
6	PF08448 PAS_4	0.087	24.5	PAS fold
7	PF13426 PAS_9	2.1e-05	36.1	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000008527	0.999	Cryptochrome-1
2	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
3	9606.ENSP00000308741	0.999	Circadian locomoter output cycles protein kaput
4	9606.ENSP00000478187	0.999	Cryptochrome-2
5	9606.ENSP00000338283	0.998	Neuronal PAS domain-containing protein 2
6	9606.ENSP00000254657	0.996	Period circadian protein homolog 2
7	9606.ENSP00000380044	0.995	Casein kinase I isoform epsilon
8	9606.ENSP00000246672	0.993	Nuclear receptor subfamily 1 group D member 1
9	9606.ENSP00000263253	0.993	Histone acetyltransferase p300
10	9606.ENSP00000222122	0.992	D site-binding protein
11	9606.ENSP00000280614	0.987	Nocturnin
12	9606.ENSP00000314420	0.986	Period circadian protein homolog 1
13	9606.ENSP00000450607	0.984	Protein timeless homolog
14	9606.ENSP00000242728	0.982	Class E basic helix-loop-helix protein 41
15	9606.ENSP00000256495	0.979	Class E basic helix-loop-helix protein 40
16	9606.ENSP00000261523	0.974	Nuclear receptor ROR-alpha
17	9606.ENSP00000385523	0.974	Peroxisome proliferator-activated receptor alpha
18	9606.ENSP00000222553	0.970	Nicotinamide phosphoribosyltransferase
19	9606.ENSP00000324464	0.960	Casein kinase I isoform delta
20	9606.ENSP00000264867	0.959	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0043565	0.992	sequence-specific DNA binding
GO:0003690	0.989	double-stranded DNA binding
GO:1990837	0.983	sequence-specific double-stranded DNA binding
GO:0001067	0.961	transcription regulatory region nucleic acid binding
GO:0000976	0.934	transcription cis-regulatory region binding
GO:0140110	0.911	transcription regulator activity
GO:0003700	0.832	DNA-binding transcription factor activity
GO:0003682	0.525	chromatin binding
GO:0000981	0.510	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.494	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.488	transcription factor binding
GO:0000987	0.412	cis-regulatory region sequence-specific DNA binding
GO:0061629	0.405	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	0.375	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0050794	0.987	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0009891	0.965	positive regulation of biosynthetic process
GO:0045893	0.959	positive regulation of DNA-templated transcription
GO:0048511	0.951	rhythmic process
GO:0007623	0.895	circadian rhythm
GO:0050896	0.859	response to stimulus
GO:0009987	0.520	cellular process
GO:0048519	0.484	negative regulation of biological process
GO:0048523	0.418	negative regulation of cellular process
GO:0006357	0.370	regulation of transcription by RNA polymerase II
GO:0009892	0.312	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005667	0.833	transcription regulator complex
GO:0005737	0.738	cytoplasm
GO:0043232	0.489	intracellular non-membrane-bounded organelle
GO:0140513	0.384	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]