StarFunc result for job id O00337

User Input

>input (649 residues)
MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFS
RWRNLQPALRARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVL
TFLGHRLLKRLLGPKLRRFLKPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLV
SFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTEPGFIAFEWLGEQIRI
FLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISF
GIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWE
DCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCG
FANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00337	1.000	1.000	4.562E-84	649	1.000	1.000	O00337.pdb.gz	S28A1_HUMAN Sodium/nucleoside cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC28A1 PE=1 SV=2
2	AFDB:E9PXX9	0.912	0.913	1.046E-73	648	0.837	0.838	E9PXX9.pdb.gz	S28A1_MOUSE Sodium/nucleoside cotransporter 1 OS=Mus musculus OX=10090 GN=Slc28a1 PE=2 SV=1
3	AFDB:O88627	0.884	0.869	2.586E-61	660	0.619	0.609	O88627.pdb.gz	S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus OX=10090 GN=Slc28a2 PE=1 SV=2
4	AFDB:O43868	0.858	0.847	1.535E-60	658	0.638	0.629	O43868.pdb.gz	S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC28A2 PE=2 SV=2
5	AFDB:B7Z3L6	0.630	0.836	3.161E-49	483	0.744	1.000	B7Z3L6.pdb.gz	B7Z3L6_HUMAN Solute carrier family 28 member 1 OS=Homo sapiens OX=9606 GN=SLC28A1 PE=1 SV=1
6	AFDB:Q8VIH3	0.798	0.738	2.487E-46	705	0.448	0.413	Q8VIH3.pdb.gz	S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus OX=10116 GN=Slc28a3 PE=2 SV=1
7	AFDB:Q9HAS3	0.792	0.746	5.029E-46	691	0.444	0.417	Q9HAS3.pdb.gz	S28A3_HUMAN Solute carrier family 28 member 3 OS=Homo sapiens OX=9606 GN=SLC28A3 PE=1 SV=1
8	PDB:6kswA	0.740	0.931	3.213E-37	513	0.399	0.505	6kswA.pdb.gz
9	AFDB:Q7K4A1	0.707	0.758	2.685E-34	603	0.302	0.325	Q7K4A1.pdb.gz	Q7K4A1_DROME Sodium/nucleoside cotransporter OS=Drosophila melanogaster OX=7227 GN=CNT2 PE=2 SV=1
10	AFDB:Q5B1T7	0.697	0.735	2.027E-31	614	0.263	0.279	Q5B1T7.pdb.gz	Q5B1T7_EMENI Nucleoside transporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05493 PE=3 SV=1
11	AFDB:Q9KPL5	0.604	0.932	6.306E-30	418	0.237	0.368	Q9KPL5.pdb.gz	Q9KPL5_VIBCH Nucleoside permease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=VC_2352 PE=1 SV=1
12	PDB:4pb1A	0.588	0.938	1.251E-29	404	0.231	0.371	4pb1A.pdb.gz	Structural basis of nucleoside and nucleoside drug selectivity by concentrative nucleoside transporters.
13	PDB:4f35B	0.234	0.332	3.231E-2	414	0.100	0.157	4f35B.pdb.gz	Structure and mechanism of a bacterial sodium-dependent dicarboxylate transporter.
14	PDB:6ob6B	0.125	0.169	3.975E-2	357	0.083	0.151	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
15	PDB:6gs1A	0.097	0.116	4.889E-2	472	0.092	0.127	6gs1A.pdb.gz
16	PDB:6ob7A	0.122	0.161	7.398E-2	381	0.083	0.142	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
17	PDB:2witA	0.077	0.087	1.765E-1	531	0.100	0.122	2witA.pdb.gz
18	PDB:6s4mA	0.099	0.124	1.918E-1	426	0.077	0.117	6s4mA.pdb.gz
19	PDB:5y50A	0.111	0.145	2.459E-1	448	0.102	0.147	5y50A.pdb.gz
20	PDB:4f4cA	0.082	0.050	4.213E-1	1250	0.068	0.035	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z3L6	0.0	736	483	0.559	0.752	B7Z3L6_HUMAN Solute carrier family 28 member 1 OS=Homo sapiens OX=9606 GN=SLC28A1 PE=1 SV=1
2	E9PXX9	0.0	1103	648	0.838	0.840	S28A1_MOUSE Sodium/nucleoside cotransporter 1 OS=Mus musculus OX=10090 GN=Slc28a1 PE=2 SV=1
3	O00337	0.0	1317	649	1.000	1.000	S28A1_HUMAN Sodium/nucleoside cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC28A1 PE=1 SV=2
4	O43868	0.0	813	658	0.638	0.629	S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC28A2 PE=2 SV=2
5	O88627	0.0	826	660	0.630	0.620	S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus OX=10090 GN=Slc28a2 PE=1 SV=2
6	Q62674	0.0	1093	648	0.826	0.827	S28A1_RAT Sodium/nucleoside cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc28a1 PE=1 SV=1
7	Q62773	0.0	820	659	0.632	0.622	S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus OX=10116 GN=Slc28a2 PE=1 SV=1
8	Q9ERH8	2.67e-179	527	703	0.436	0.403	S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus OX=10090 GN=Slc28a3 PE=2 SV=1
9	Q8VIH3	1.02e-177	523	705	0.427	0.393	S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus OX=10116 GN=Slc28a3 PE=2 SV=1
10	Q9HAS3	2.48e-174	514	691	0.425	0.399	S28A3_HUMAN Solute carrier family 28 member 3 OS=Homo sapiens OX=9606 GN=SLC28A3 PE=1 SV=1
11	Q7K4A1	1.11e-104	332	603	0.271	0.292	Q7K4A1_DROME Sodium/nucleoside cotransporter OS=Drosophila melanogaster OX=7227 GN=CNT2 PE=2 SV=1
12	Q9KPL5	7.85e-79	258	418	0.240	0.373	Q9KPL5_VIBCH Nucleoside permease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=VC_2352 PE=1 SV=1
13	Q5B1T7	3.83e-72	246	614	0.227	0.239	Q5B1T7_EMENI Nucleoside transporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05493 PE=3 SV=1
14	A0A1D8PHJ7	3.10e-68	236	608	0.210	0.224	A0A1D8PHJ7_CANAL Cntp OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CNT PE=3 SV=1
15	P33021	2.67e-63	217	416	0.203	0.317	NUPX_ECOLI Putative nucleoside permease NupX OS=Escherichia coli (strain K12) OX=83333 GN=nupX PE=1 SV=1
16	P33024	5.34e-62	214	416	0.208	0.325	PSUT_ECOLI Putative pseudouridine transporter OS=Escherichia coli (strain K12) OX=83333 GN=psuT PE=1 SV=1
17	P0AFF2	1.17e-25	112	400	0.157	0.255	NUPC_ECOLI Nucleoside permease NupC OS=Escherichia coli (strain K12) OX=83333 GN=nupC PE=1 SV=1
18	P24183	0.17	37.7	1015	0.052	0.033	FDNG_ECOLI Formate dehydrogenase, nitrate-inducible, major subunit OS=Escherichia coli (strain K12) OX=83333 GN=fdnG PE=1 SV=3
19	P32176	0.53	35.8	1016	0.049	0.031	FDOG_ECOLI Formate dehydrogenase-O major subunit OS=Escherichia coli (strain K12) OX=83333 GN=fdoG PE=1 SV=5
20	Q9JHG3	1.4	34.3	377	0.037	0.064	APJ_RAT Apelin receptor OS=Rattus norvegicus OX=10116 GN=Aplnr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07670 Gate	0.0037	28.9	Nucleoside recognition
2	PF07662 Nucleos_tra2_C	3.6e-75	263.9	Na+ dependent nucleoside transporter C-terminus
3	PF01773 Nucleos_tra2_N	1.2e-19	81.9	Na+ dependent nucleoside transporter N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377424	0.894	Equilibrative nucleoside transporter 1
2	9606.ENSP00000350024	0.880	Equilibrative nucleoside transporter 2
3	9606.ENSP00000355930	0.764	Solute carrier family 22 member 1
4	9606.ENSP00000362285	0.758	Equilibrative nucleoside transporter 3
5	9606.ENSP00000380081	0.690	Equilibrative nucleoside transporter 4
6	9606.ENSP00000286648	0.685	Deoxycytidine kinase
7	9606.ENSP00000364212	0.680	Cytidine deaminase
8	9606.ENSP00000358515	0.678	Solute carrier family 22 member 15
9	9606.ENSP00000405812	0.662	Electroneutral sodium bicarbonate exchanger 1
10	9606.ENSP00000361666	0.619	Solute carrier family 22 member 7
11	9606.ENSP00000362018	0.587	Centromere protein I
12	9606.ENSP00000200652	0.576	Solute carrier family 22 member 4
13	9606.ENSP00000315644	0.573	Thymidylate synthase
14	9606.ENSP00000194130	0.568	Solute carrier family 13 member 1
15	9606.ENSP00000296589	0.567	Membrane-associated transporter protein
16	9606.ENSP00000245407	0.557	Solute carrier family 22 member 5
17	9606.ENSP00000349576	0.556	Deoxycytidylate deaminase
18	9606.ENSP00000333926	0.549	Multidrug resistance-associated protein 5
19	9606.ENSP00000365686	0.549	Solute carrier family 15 member 1
20	9606.ENSP00000301634	0.535	Thymidine kinase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005415	1.000	nucleoside:sodium symporter activity
GO:1901474	0.858	azole transmembrane transporter activity
GO:0015214	0.803	pyrimidine nucleoside transmembrane transporter activity
GO:0015213	0.786	uridine transmembrane transporter activity
GO:0005488	0.400	binding
GO:0005515	0.344	protein binding
GO:0015205	0.326	nucleobase transmembrane transporter activity
GO:0005345	0.323	purine nucleobase transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.995	localization
GO:0006810	0.987	transport
GO:0071702	0.984	organic substance transport
GO:0044237	0.950	cellular metabolic process
GO:0071704	0.944	organic substance metabolic process
GO:0055085	0.940	transmembrane transport
GO:0071705	0.937	nitrogen compound transport
GO:0044238	0.855	primary metabolic process
GO:0006807	0.836	nitrogen compound metabolic process
GO:1901264	0.832	carbohydrate derivative transport
GO:1901360	0.821	organic cyclic compound metabolic process
GO:0006725	0.813	cellular aromatic compound metabolic process
GO:0046483	0.785	heterocycle metabolic process
GO:0034641	0.771	cellular nitrogen compound metabolic process
GO:0015931	0.707	nucleobase-containing compound transport
GO:0006139	0.678	nucleobase-containing compound metabolic process
GO:0050896	0.343	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.988	intracellular anatomical structure
GO:0043227	0.988	membrane-bounded organelle
GO:0005829	0.969	cytosol
GO:0031981	0.957	nuclear lumen
GO:0098590	0.826	plasma membrane region
GO:0005654	0.732	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]