StarFunc result for job id O00370

User Input

>input (1275 residues)
MTGSNSHITILTLNVNGLNSPIKRHRLASWIKSQDPSVCCIQETHLTCRDTHRLKIKGWR
KIYQANGKQKKAGVAILVSDKTDFKPTKIKRDKEGHYIMVKGSIQQEELTILNIYAPNTG
APRFIKQVLSDLQRDLDSHTLIMGDFNTPLSILDRSTRQKVNKDTQELNSALHQTDLIDI
YRTLHPKSTEYTFFSAPHHTYSKIDHIVGSKALLSKCKRTEIITNYLSDHSAIKLELRIK
NLTQSRSTTWKLNNLLLNDYWVHNEMKAEIKMFFETNENKDTTYQNLWDAFKAVCRGKFI
ALNAYKRKQERSKIDTLTSQLKELEKQEQTHSKASRRQEITKIRAELKEIETQKTLQKIN
ESRSWFFERINKIDRPLARLIKKKREKNQIDTIKNDKGDITTDPTEIQTTIREYYKHLYA
NKLENLEEMDTFLDTYTLPRLNQEEVESLNRPITGSEIVAIINSLPTKKSPGPDGFTAEF
YQRYKEELVPFLLKLFQSIEKEGILPNSFYEASIILIPKPGRDTTKKENFRPISLMNIDA
KILNKILANRIQQHIKKLIHHDQVGFIPGMQGWFNIRKSINVIQHINRAKDKNHVIISID
AEKAFDKIQQPFMLKTLNKLGIDGMYLKIIRAIYDKPTANIILNGQKLEAFPLKTGTRQG
CPLSPLLFNIVLEVLARAIRQEKEIKGIQLGKEEVKLSLFADDMIVYLENPIVSAQNLLK
LISNFSKVSGYKINVQKSQAFLYNNNRQTESQIMGELPFTIASKRIKYLGIQLTRDVKDL
FKENYKPLLKEIKEDTNKWKNIPCSWVGRINIVKMAILPKVIYRFNAIPIKLPMTFFTEL
EKTTLKFIWNQKRARIAKSILSQKNKAGGITLPDFKLYYKATVTKTAWYWYQNRDIDQWN
RTEPSEIMPHIYNYLIFDKPEKNKQWGKDSLLNKWCWENWLAICRKLKLDPFLTPYTKIN
SRWIKDLNVKPKTIKTLEENLGITIQDIGVGKDFMSKTPKAMATKDKIDKWDLIKLKSFC
TAKETTIRVNRQPTTWEKIFATYSSDKGLISRIYNELKQIYKKKTNNPIKKWAKDMNRHF
SKEDIYAAKKHMKKCSSSLAIREMQIKTTMRYHLTPVRMAIIKKSGNNRCWRGCGEIGTL
VHCWWDCKLVQPLWKSVWRFLRDLELEIPFDPAIPLLGIYPKDYKSCCYKDTCTRMFIAA
LFTIAKTWNQPNCPTMIDWIKKMWHIYTMEYYAAIKNDEFISFVGTWMKLETIILSKLSQ
EQKTKHRIFSLIGGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5Z0F6	0.984	0.986	0.000	1272	0.671	0.673	A5Z0F6.pdb.gz	A5Z0F6_PIG Endonuclease/reverse transcriptase OS=Sus scrofa OX=9823 PE=4 SV=1
2	AFDB:O00370	1.000	1.000	0.000	1275	1.000	1.000	O00370.pdb.gz	LORF2_HUMAN LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	AFDB:P11369	0.981	0.976	0.000	1281	0.623	0.620	P11369.pdb.gz	LORF2_MOUSE LINE-1 retrotransposable element ORF2 protein OS=Mus musculus OX=10090 GN=Pol PE=1 SV=2
4	AFDB:A0A1D8PSY7	0.528	0.581	2.316E-40	1149	0.164	0.182	A0A1D8PSY7.pdb.gz	A0A1D8PSY7_CANAL Fgr14p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR14 PE=4 SV=1
5	AFDB:Q54DH4	0.469	0.472	2.629E-37	1264	0.159	0.161	Q54DH4.pdb.gz	Q54DH4_DICDI Reverse transcriptase domain-containing protein (Fragment) OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292260 PE=4 SV=1
6	AFDB:Q95SX7	0.426	0.575	4.161E-31	906	0.136	0.191	Q95SX7.pdb.gz	RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster OX=7227 GN=RTase PE=2 SV=1
7	AFDB:Q9NBX4	0.442	0.591	2.440E-30	908	0.126	0.177	Q9NBX4.pdb.gz	RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster OX=7227 GN=X-element\ORF2 PE=3 SV=1
8	PDB:1akoA	0.162	0.704	6.797E-12	268	0.046	0.220	1akoA.pdb.gz
9	AFDB:P09030	0.163	0.715	6.967E-11	268	0.045	0.213	P09030.pdb.gz	EX3_ECOLI Exodeoxyribonuclease III OS=Escherichia coli (strain K12) OX=83333 GN=xthA PE=1 SV=4
10	PDB:2j63A	0.164	0.574	1.682E-10	333	0.038	0.144	2j63A.pdb.gz
11	AFDB:Q57X31	0.158	0.476	2.494E-10	396	0.042	0.136	Q57X31.pdb.gz	Q57X31_TRYB2 DNA-(apurinic or apyrimidinic site) endonuclease OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.110 PE=3 SV=1
12	PDB:2o3cB	0.159	0.663	2.538E-10	280	0.047	0.214	2o3cB.pdb.gz
13	AFDB:A0MTA1	0.164	0.624	2.708E-10	310	0.047	0.194	A0MTA1.pdb.gz	APEX1_DANRE DNA-(apurinic or apyrimidinic site) endonuclease OS=Danio rerio OX=7955 GN=apex1 PE=1 SV=1
14	PDB:7cd5A	0.165	0.696	3.527E-10	278	0.045	0.209	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
15	PDB:6o1kA	0.164	0.733	2.875E-9	262	0.030	0.145	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
16	PDB:4f1iA	0.143	0.487	1.374E-7	328	0.032	0.125	4f1iA.pdb.gz
17	PDB:7ax1A	0.142	0.315	5.339E-7	518	0.042	0.102	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
18	PDB:7kiuA	0.144	0.609	1.375E-6	263	0.032	0.156	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
19	PDB:5ganA	0.224	0.141	1.689E-6	2196	0.067	0.039	5ganA.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
20	PDB:5lqwA	0.254	0.170	3.400E-6	2130	0.081	0.048	5lqwA.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5Z0F6	0.0	1802	1272	0.671	0.672	A5Z0F6_PIG Endonuclease/reverse transcriptase OS=Sus scrofa OX=9823 PE=4 SV=1
2	O00370	0.0	2625	1275	1.000	1.000	LORF2_HUMAN LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	P11369	0.0	1700	1281	0.625	0.622	LORF2_MOUSE LINE-1 retrotransposable element ORF2 protein OS=Mus musculus OX=10090 GN=Pol PE=1 SV=2
4	Q8TE30	0.0	2584	1275	0.984	0.984	Q8TE30_HUMAN RNA-directed DNA polymerase OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q14755	3.57e-68	227	138	0.090	0.833	Q14755_HUMAN Lamin-like protein in HindIII repetitive element derived DNA, 3' end (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	Q54DH4	7.24e-36	150	1264	0.096	0.097	Q54DH4_DICDI Reverse transcriptase domain-containing protein (Fragment) OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292260 PE=4 SV=1
7	A0A1D8PSY7	9.88e-27	121	1149	0.071	0.079	A0A1D8PSY7_CANAL Fgr14p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR14 PE=4 SV=1
8	Q95SX7	2.64e-14	80.5	906	0.071	0.099	RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster OX=7227 GN=RTase PE=2 SV=1
9	Q9NBX4	3.77e-11	70.1	908	0.121	0.170	RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster OX=7227 GN=X-element\ORF2 PE=3 SV=1
10	P28352	8.54e-06	51.6	317	0.050	0.202	APEX1_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease OS=Mus musculus OX=10090 GN=Apex1 PE=1 SV=2
11	P43138	9.33e-06	51.6	317	0.050	0.202	APEX1_RAT DNA-(apurinic or apyrimidinic site) endonuclease OS=Rattus norvegicus OX=10116 GN=Apex1 PE=1 SV=2
12	P51173	1.01e-05	51.6	361	0.050	0.177	APEA_DICDI DNA-(apurinic or apyrimidinic site) endonuclease OS=Dictyostelium discoideum OX=44689 GN=apeA PE=2 SV=2
13	A0MTA1	6.17e-05	48.9	310	0.052	0.213	APEX1_DANRE DNA-(apurinic or apyrimidinic site) endonuclease OS=Danio rerio OX=7955 GN=apex1 PE=1 SV=1
14	P45951	8.19e-05	49.3	536	0.045	0.108	ARP_ARATH DNA-(apurinic or apyrimidinic site) endonuclease, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ARP PE=1 SV=2
15	E5KN95	1.28e-04	48.5	518	0.055	0.135	E5KN95_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX2 PE=3 SV=1
16	Q9UBZ4	1.28e-04	48.5	518	0.055	0.135	APEX2_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Homo sapiens OX=9606 GN=APEX2 PE=1 SV=1
17	Q68G58	1.38e-04	48.5	516	0.056	0.138	APEX2_MOUSE DNA-(apurinic or apyrimidinic site) endonuclease 2 OS=Mus musculus OX=10090 GN=Apex2 PE=1 SV=1
18	P27695	4.33e-04	46.2	318	0.050	0.201	APEX1_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2
19	Q5TZP7	4.33e-04	46.2	318	0.050	0.201	Q5TZP7_HUMAN DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=2 SV=1
20	G5EBR7	0.006	42.7	288	0.027	0.118	G5EBR7_CAEEL DNA-(apurinic or apyrimidinic site) endonuclease OS=Caenorhabditis elegans OX=6239 GN=exo-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08333 DUF1725	0.075	24.0	Protein of unknown function (DUF1725)
2	PF14386 DUF4417	83	14.3	Domain of unknown function (DUF4417)
3	PF03372 Exo_endo_phos	7.2e-08	43.9	Endonuclease/Exonuclease/phosphatase family
4	PF14529 Exo_endo_phos_2	1.1e-06	40.0	Endonuclease-reverse transcriptase
5	PF00078 RVT_1	6.7e-52	187.8	Reverse transcriptase (RNA-dependent DNA polymerase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000023819

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017489	0.734	Retinitis pigmentosa GTPase regulator interacting protein 1
2	61853.ENSNLEP00000017234	0.617	Phosphodiesterase 6D, cGMP-specific, rod, delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.978	catalytic activity
GO:0016788	0.974	hydrolase activity, acting on ester bonds
GO:0140097	0.836	catalytic activity, acting on DNA
GO:0004520	0.785	DNA endonuclease activity
GO:0016893	0.781	endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
GO:0003964	0.776	RNA-directed DNA polymerase activity
GO:0016888	0.514	endodeoxyribonuclease activity, producing 5'-phosphomonoesters

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0090305	0.943	nucleic acid phosphodiester bond hydrolysis
GO:0050896	0.411	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0032991	0.566	protein-containing complex
GO:0043227	0.452	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.974	Acting on ester bonds.
EC:3.1.30.-	0.781	Endoribonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.
EC:2.7.7.49	0.776	RNA-directed DNA polymerase.
EC:3.1.21.-	0.514	Endodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]