StarFunc result for job id O00391

User Input

>input (747 residues)
MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSA
WAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPT
VRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
ARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLL
FRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKIY
MADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKR
QKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAAR
QNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSS
HNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNI
ILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDPGKPEMMKSPTNTTPHVPAEG
PEASRPPKLHPGLRAAPGQEPPEHMAELQRNEQEQPLGQWHLSKRDTGAALLAESRAEKN
RLWGPLEVRRVGRSSKQLVDIPEGQLEARAGRGRGQWLQVLGGGFSYLDISLCVGLYSLS
FMGLLAMYTYFQAKIRALKGHAGHPAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00391	1.000	1.000	0.000	747	1.000	1.000	O00391.pdb.gz	QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens OX=9606 GN=QSOX1 PE=1 SV=3
2	AFDB:Q8BND5	0.723	0.722	5.242E-95	748	0.728	0.727	Q8BND5.pdb.gz	QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus OX=10090 GN=Qsox1 PE=1 SV=1
3	AFDB:Q6IUU3	0.715	0.712	1.185E-94	750	0.731	0.728	Q6IUU3.pdb.gz	QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus OX=10116 GN=Qsox1 PE=1 SV=1
4	AFDB:Q13876	0.604	0.570	7.241E-80	793	0.692	0.652	Q13876.pdb.gz	Q13876_HUMAN Bone-derived growth factor (Fragment) OS=Homo sapiens OX=9606 GN=BPGF-1 PE=2 SV=1
5	AFDB:Q6ZRP7	0.654	0.699	3.947E-58	698	0.380	0.407	Q6ZRP7.pdb.gz	QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens OX=9606 GN=QSOX2 PE=1 SV=3
6	PDB:3ed3A	0.214	0.488	4.626E-9	267	0.059	0.165	3ed3A.pdb.gz
7	PDB:4ekzA	0.152	0.229	1.282E-8	469	0.066	0.104	4ekzA.pdb.gz
8	PDB:3apoA	0.230	0.248	2.028E-8	688	0.052	0.057	3apoA.pdb.gz
9	PDB:5gu6A	0.134	0.251	2.134E-8	377	0.059	0.117	5gu6A.pdb.gz
10	PDB:3f8uA	0.148	0.226	5.915E-8	469	0.063	0.100	3f8uA.pdb.gz
11	PDB:7f05C	0.131	0.246	4.738E-6	355	0.033	0.070	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
12	PDB:2r2jA	0.137	0.298	1.018E-5	328	0.044	0.101	2r2jA.pdb.gz
13	PDB:5crgA	0.130	0.243	1.783E-5	354	0.044	0.093	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
14	PDB:4f9zA	0.132	0.386	4.695E-5	219	0.044	0.151	4f9zA.pdb.gz
15	PDB:5xocB	0.131	0.645	6.058E-5	133	0.050	0.278	5xocB.pdb.gz
16	AFDB:Q8RWQ4	0.090	0.081	1.679E-3	870	0.114	0.098	Q8RWQ4.pdb.gz	RGAP7_ARATH Rho GTPase-activating protein 7 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP7 PE=2 SV=1
17	AFDB:Q9FMP8	0.082	0.076	2.657E-3	827	0.102	0.092	Q9FMP8.pdb.gz	RGAP6_ARATH Rho GTPase-activating protein 6 OS=Arabidopsis thaliana OX=3702 GN=ROPGAP6 PE=2 SV=1
18	AFDB:O60312	0.062	0.038	1.097E-1	1499	0.080	0.040	O60312.pdb.gz	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
19	AFDB:A2BGA0	0.070	0.070	1.278E-1	735	0.124	0.127	A2BGA0.pdb.gz	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
20	AFDB:Q387G7	0.084	0.078	1.567E-1	835	0.072	0.065	Q387G7.pdb.gz	Q387G7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0310 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKE5	0.0	1241	604	0.806	0.997	A0A140VKE5_HUMAN Sulfhydryl oxidase OS=Homo sapiens OX=9606 GN=QSCN6 PE=2 SV=1
2	O00391	0.0	1535	747	1.000	1.000	QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens OX=9606 GN=QSOX1 PE=1 SV=3
3	Q13876	0.0	984	793	0.703	0.662	Q13876_HUMAN Bone-derived growth factor (Fragment) OS=Homo sapiens OX=9606 GN=BPGF-1 PE=2 SV=1
4	Q6IUU3	0.0	1057	750	0.728	0.725	QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus OX=10116 GN=Qsox1 PE=1 SV=1
5	Q8BND5	0.0	1063	748	0.708	0.707	QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus OX=10090 GN=Qsox1 PE=1 SV=1
6	Q6ZRP7	1.47e-151	459	698	0.321	0.344	QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens OX=9606 GN=QSOX2 PE=1 SV=3
7	Q7JQR3	2.44e-79	268	637	0.241	0.283	Q7JQR3_DROME Sulfhydryl oxidase OS=Drosophila melanogaster OX=7227 GN=Qsox1 PE=1 SV=1
8	Q9VD61	2.83e-77	261	552	0.225	0.304	Q9VD61_DROME Sulfhydryl oxidase OS=Drosophila melanogaster OX=7227 GN=Qsox2 PE=2 SV=1
9	Q9VD62	3.79e-54	198	562	0.207	0.276	Q9VD62_DROME Sulfhydryl oxidase OS=Drosophila melanogaster OX=7227 GN=Qsox3 PE=3 SV=1
10	Q8IMY4	1.90e-48	182	561	0.201	0.267	Q8IMY4_DROME Sulfhydryl oxidase OS=Drosophila melanogaster OX=7227 GN=Qsox4 PE=3 SV=1
11	Q8W4J3	6.36e-25	111	528	0.102	0.144	QSOX1_ARATH Sulfhydryl oxidase 1 OS=Arabidopsis thaliana OX=3702 GN=QSOX1 PE=2 SV=1
12	Q585M6	8.28e-25	111	526	0.102	0.144	Q585M6_TRYB2 Sulfhydryl oxidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.860 PE=1 SV=1
13	Q9ZU40	2.33e-24	109	495	0.080	0.121	QSOX2_ARATH Sulfhydryl oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=QSOX2 PE=2 SV=2
14	O48773	4.55e-13	74.3	440	0.050	0.084	PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
15	Q00216	6.17e-12	70.1	359	0.056	0.117	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
16	Q86IA3	1.10e-11	69.3	363	0.051	0.105	PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum OX=44689 GN=pdi1 PE=1 SV=2
17	Q9V438	1.14e-11	70.1	433	0.050	0.085	PDIA6_DROME Protein disulfide-isomerase A6 homolog OS=Drosophila melanogaster OX=7227 GN=CaBP1 PE=1 SV=1
18	Q9MAU6	1.26e-11	69.7	447	0.046	0.076	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
19	Q91W90	4.95e-11	67.8	417	0.092	0.165	TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus OX=10090 GN=Txndc5 PE=1 SV=2
20	Q11067	1.10e-10	67.0	440	0.043	0.073	PDIA6_CAEEL Protein disulfide-isomerase A6 homolog OS=Caenorhabditis elegans OX=6239 GN=pdi-6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12172 DUF35_N	4e+02	12.3	Rubredoxin-like zinc ribbon domain (DUF35_N)
2	PF04777 Evr1_Alr	1.3e-19	81.6	Erv1 / Alr family
3	PF18371 FAD_SOX	1.7e-39	145.7	Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
4	PF18108 QSOX_Trx1	1.1e-50	181.8	QSOX Trx-like domain
5	PF00085 Thioredoxin	1.6e-12	58.7	Thioredoxin
6	PF13098 Thioredoxin_2	42	16.0	Thioredoxin-like domain
7	PF13899 Thioredoxin_7	4.6e+02	12.4	Thioredoxin-like
8	PF13905 Thioredoxin_8	2.1e+02	13.6	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000248114	0.750	FAD-linked sulfhydryl oxidase ALR
2	9606.ENSP00000363641	0.651	Thioredoxin
3	9606.ENSP00000406861	0.643	Mucin-6
4	9606.ENSP00000344456	0.642	Catenin beta-1
5	9606.ENSP00000398273	0.640	Transcription factor SOX-5
6	9606.ENSP00000245479	0.633	Transcription factor SOX-9
7	9606.ENSP00000356917	0.608	Olfactomedin-like protein 2B
8	9606.ENSP00000356599	0.599	Torsin-3A
9	9606.ENSP00000356579	0.585	Centrosome-associated protein 350
10	9606.ENSP00000435365	0.584	Torsin-1A-interacting protein 1
11	9606.ENSP00000379644	0.572	Transcription factor SOX-6
12	9606.ENSP00000323588	0.563	Transcription factor SOX-2
13	9606.ENSP00000322568	0.561	Transcription factor SOX-11
14	9606.ENSP00000305343	0.557	Transcription factor SOX-14
15	9606.ENSP00000357292	0.556	Ubiquilin-4
16	9606.ENSP00000244745	0.545	Transcription factor SOX-4
17	9606.ENSP00000359384	0.538	Oocyte-expressed protein homolog
18	9606.ENSP00000297316	0.537	Transcription factor SOX-17
19	9606.ENSP00000293894	0.535	Transcription factor SOX-8
20	9606.ENSP00000341815	0.535	Transcription factor SOX-18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016670	1.000	oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
GO:0015035	1.000	protein-disulfide reductase activity
GO:0071949	1.000	FAD binding
GO:0003756	0.999	protein disulfide isomerase activity
GO:0005515	0.935	protein binding
GO:0016972	0.887	thiol oxidase activity
GO:0016971	0.853	flavin-linked sulfhydryl oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0048523	0.976	negative regulation of cellular process
GO:0071840	0.946	cellular component organization or biogenesis
GO:0016043	0.893	cellular component organization
GO:0031329	0.860	regulation of cellular catabolic process
GO:0009892	0.785	negative regulation of metabolic process
GO:0009895	0.743	negative regulation of catabolic process
GO:0031324	0.743	negative regulation of cellular metabolic process
GO:0044085	0.717	cellular component biogenesis
GO:0016241	0.710	regulation of macroautophagy
GO:0043062	0.692	extracellular structure organization
GO:0031330	0.689	negative regulation of cellular catabolic process
GO:0030198	0.678	extracellular matrix organization
GO:0022607	0.677	cellular component assembly
GO:0010507	0.653	negative regulation of autophagy
GO:0085029	0.642	extracellular matrix assembly
GO:0016242	0.608	negative regulation of macroautophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0070013	0.996	intracellular organelle lumen
GO:0012505	0.992	endomembrane system
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0005634	0.872	nucleus
GO:0031982	0.739	vesicle
GO:0031981	0.708	nuclear lumen
GO:0005794	0.650	Golgi apparatus
GO:1903561	0.558	extracellular vesicle
GO:0070062	0.502	extracellular exosome
GO:0005654	0.496	nucleoplasm
GO:0005783	0.460	endoplasmic reticulum
GO:0016020	0.419	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.3.-	1.000	With oxygen as acceptor.
EC:5.3.4.1	0.999	protein disulfide-isomerase.
RHEA:17357	0.887	O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'
EC:1.8.3.2	0.887	thiol oxidase.

[back to server]