StarFunc result for job id O00408

User Input

>input (941 residues)
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3VTJ2	0.501	0.501	0.000	941	0.979	0.979	B3VTJ2.pdb.gz	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
2	AFDB:Q9VJ79	0.560	0.382	1.730E-48	1451	0.249	0.161	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
3	AFDB:Q9VFI9	0.575	0.494	3.064E-48	1118	0.273	0.230	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
4	AFDB:Q8VID6	0.569	0.572	5.195E-48	935	0.235	0.236	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
5	AFDB:Q9GQU6	0.370	0.374	9.329E-46	930	0.239	0.242	Q9GQU6.pdb.gz	Q9GQU6_9TRYP Phosphodiesterase OS=Trypanosoma brucei OX=5691 GN=PDE PE=3 SV=1
6	AFDB:Q38F46	0.340	0.344	1.019E-45	930	0.230	0.232	Q38F46.pdb.gz	Q38F46_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3590 PE=3 SV=1
7	AFDB:Q9QYJ6	0.545	0.630	8.287E-44	794	0.234	0.277	Q9QYJ6.pdb.gz	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
8	AFDB:O76074	0.542	0.578	1.911E-43	875	0.221	0.238	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
9	AFDB:A0A0R4IUY2	0.558	0.608	7.045E-42	852	0.214	0.236	A0A0R4IUY2.pdb.gz
10	AFDB:P30645	0.393	0.441	3.008E-41	831	0.208	0.236	P30645.pdb.gz	PDE2_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-2 OS=Caenorhabditis elegans OX=6239 GN=pde-2 PE=3 SV=4
11	PDB:7jsnA	0.502	0.562	6.130E-37	820	0.204	0.234	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
12	PDB:6mzbB	0.547	0.624	6.038E-36	807	0.207	0.242	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
13	PDB:4y86B	0.322	0.916	1.695E-19	326	0.089	0.258	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
14	PDB:3bjcA	0.309	0.905	5.240E-18	311	0.112	0.338	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:1vhmB	0.142	0.713	4.696E-5	160	0.024	0.144	1vhmB.pdb.gz
16	PDB:1f5mB	0.139	0.647	6.389E-5	177	0.030	0.158	1f5mB.pdb.gz
17	PDB:7rzwB	0.209	0.226	8.693E-5	864	0.037	0.041	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:4zmuA	0.137	0.342	3.113E-4	341	0.036	0.100	4zmuA.pdb.gz
19	PDB:5loeA	0.141	0.421	6.575E-4	258	0.036	0.132	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:1l3lB	0.112	0.354	5.349E-2	233	0.021	0.086	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3VTJ2	0.0	1918	941	0.980	0.980	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
2	G1U4Q4	0.0	1735	936	0.902	0.907	G1U4Q4_RABIT Phosphodiesterase OS=Oryctolagus cuniculus OX=9986 GN=PDE2A PE=3 SV=2
3	O00408	0.0	1956	941	1.000	1.000	PDE2A_HUMAN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE2A PE=1 SV=1
4	P14099	0.0	1784	921	0.914	0.934	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2
5	Q01062	0.0	1747	928	0.900	0.913	PDE2A_RAT cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde2a PE=1 SV=2
6	Q922S4	0.0	1811	939	0.933	0.935	PDE2A_MOUSE cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde2a PE=1 SV=4
7	P30645	3.21e-112	367	831	0.208	0.236	PDE2_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-2 OS=Caenorhabditis elegans OX=6239 GN=pde-2 PE=3 SV=4
8	Q9HCR9	3.18e-111	367	933	0.254	0.256	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
9	Q8VID6	1.46e-109	362	935	0.249	0.250	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
10	Q9VJ79	1.20e-108	369	1451	0.226	0.147	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
11	Q9VFI9	3.26e-106	357	1118	0.243	0.205	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
12	Q9QYJ6	1.97e-102	339	794	0.221	0.262	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
13	Q8CA95	2.45e-101	336	790	0.219	0.261	PDE10_MOUSE cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Mus musculus OX=10090 GN=Pde10a PE=1 SV=2
14	Q9Y233	3.60e-101	335	779	0.220	0.266	PDE10_HUMAN cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Homo sapiens OX=9606 GN=PDE10A PE=1 SV=1
15	P91119	1.48e-99	330	728	0.203	0.262	PDE5_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-5 OS=Caenorhabditis elegans OX=6239 GN=pde-5 PE=3 SV=3
16	O76074	1.60e-82	287	875	0.233	0.250	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
17	P35913	4.99e-82	285	854	0.223	0.246	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
18	O54735	3.92e-81	282	833	0.227	0.257	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
19	Q8CG03	2.69e-80	280	865	0.226	0.246	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
20	P23439	4.50e-80	280	853	0.224	0.247	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	1.9e-21	88.5	GAF domain
2	PF13185 GAF_2	5.8e-16	70.5	GAF domain
3	PF13492 GAF_3	7.8e-06	37.7	GAF domain
4	PF00233 PDEase_I	1.4e-72	255.7	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485525	0.914	Adenylosuccinate lyase
2	9606.ENSP00000286621	0.909	Adenosine kinase
3	9606.ENSP00000286648	0.908	Deoxycytidine kinase
4	9606.ENSP00000371230	0.902	GTP:AMP phosphotransferase AK3, mitochondrial
5	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
6	9606.ENSP00000328412	0.887	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
7	9606.ENSP00000356825	0.866	Adenylate cyclase type 10
8	9606.ENSP00000254854	0.855	Retinal guanylyl cyclase 1
9	9606.ENSP00000312126	0.825	Adenylate cyclase type 4
10	9606.ENSP00000282249	0.821	Guanylate cyclase soluble subunit alpha-2
11	9606.ENSP00000419361	0.819	Adenylate cyclase type 5
12	9606.ENSP00000260600	0.811	Adenylate cyclase type 3
13	9606.ENSP00000286355	0.810	Adenylate cyclase type 8
14	9606.ENSP00000357669	0.809	Atrial natriuretic peptide receptor 1
15	9606.ENSP00000341083	0.800	Atrial natriuretic peptide receptor 2
16	9606.ENSP00000297323	0.794	Adenylate cyclase type 1
17	9606.ENSP00000296518	0.786	Guanylate cyclase 1, soluble, alpha 3
18	9606.ENSP00000264424	0.785	Guanylate cyclase soluble subunit beta-1
19	9606.ENSP00000218006	0.778	Retinal guanylyl cyclase 2
20	9606.ENSP00000261170	0.777	Heat-stable enterotoxin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	1.000	3',5'-cyclic-GMP phosphodiesterase activity
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0030553	1.000	cGMP binding
GO:0032559	0.999	adenyl ribonucleotide binding
GO:0042803	0.995	protein homodimerization activity
GO:0030552	0.993	cAMP binding
GO:0019904	0.775	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0006753	0.995	nucleoside phosphate metabolic process
GO:0065007	0.988	biological regulation
GO:0009150	0.987	purine ribonucleotide metabolic process
GO:0009166	0.985	nucleotide catabolic process
GO:1901136	0.982	carbohydrate derivative catabolic process
GO:0006195	0.977	purine nucleotide catabolic process
GO:0009154	0.972	purine ribonucleotide catabolic process
GO:0050794	0.965	regulation of cellular process
GO:0050896	0.962	response to stimulus
GO:0009187	0.959	cyclic nucleotide metabolic process
GO:0051716	0.818	cellular response to stimulus
GO:0023052	0.776	signaling
GO:0007154	0.775	cell communication
GO:0007165	0.749	signal transduction
GO:0032501	0.552	multicellular organismal process
GO:0048583	0.459	regulation of response to stimulus
GO:0023051	0.435	regulation of signaling
GO:0043949	0.427	regulation of cAMP-mediated signaling
GO:0032502	0.393	developmental process
GO:0048856	0.368	anatomical structure development
GO:0048519	0.335	negative regulation of biological process
GO:0042221	0.334	response to chemical
GO:0052652	0.302	cyclic purine nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.979	cytosol
GO:0005634	0.805	nucleus
GO:0005739	0.736	mitochondrion
GO:0031090	0.692	organelle membrane
GO:0070013	0.648	intracellular organelle lumen
GO:0031975	0.628	envelope
GO:0031967	0.584	organelle envelope
GO:0005740	0.569	mitochondrial envelope
GO:0098588	0.562	bounding membrane of organelle
GO:0120025	0.378	plasma membrane bounded cell projection
GO:0031968	0.307	organelle outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
RHEA:16957	1.000	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.
EC:3.1.4.35	1.000	3',5'-cyclic-GMP phosphodiesterase.

[back to server]