StarFunc result for job id O00409

User Input

>input (490 residues)
MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL
TNLNWLHESKNLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFS
CLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERS
QSIGKGSLWCIDPEYRQNLIQALKKTPYHPHPHVFNTPPTCPQAYQSTSGPPIWPGSTFF
KRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGARVLSRGLFPGVRPLPITPIG
VTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSS
SADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKG
QKEQKETTKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00409	1.000	1.000	1.568E-75	490	1.000	1.000	O00409.pdb.gz	FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3 PE=1 SV=1
2	AFDB:Q499D0	0.378	0.403	5.232E-60	457	0.884	0.947	Q499D0.pdb.gz	FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus OX=10090 GN=Foxn3 PE=1 SV=1
3	AFDB:Q01167	0.198	0.152	1.942E-13	660	0.210	0.156	Q01167.pdb.gz	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
4	AFDB:P85037	0.196	0.134	2.069E-13	733	0.178	0.119	P85037.pdb.gz	FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1
5	AFDB:O73862	0.172	0.200	8.865E-13	420	0.176	0.205	O73862.pdb.gz	O73862_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=BF-1 PE=2 SV=1
6	AFDB:Q13461	0.180	0.272	9.444E-13	319	0.145	0.223	Q13461.pdb.gz	FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens OX=9606 GN=FOXE3 PE=1 SV=2
7	AFDB:O54743	0.194	0.212	1.072E-12	446	0.204	0.224	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
8	AFDB:F1QJW8	0.191	0.321	1.894E-12	285	0.145	0.249	F1QJW8.pdb.gz	F1QJW8_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-like PE=2 SV=2
9	AFDB:O60129	0.199	0.153	2.949E-12	642	0.182	0.139	O60129.pdb.gz	FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh2 PE=1 SV=1
10	AFDB:Q1JPV2	0.193	0.301	1.734E-11	306	0.151	0.242	Q1JPV2.pdb.gz	Q1JPV2_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-1 PE=2 SV=1
11	PDB:2hdcA	0.153	0.610	1.085E-6	97	0.080	0.402	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:2qbyB	0.140	0.180	1.967E-2	368	0.029	0.038	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
13	PDB:4xgcE	0.140	0.166	2.379E-2	402	0.033	0.040	4xgcE.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
14	PDB:2qbyA	0.137	0.177	5.082E-2	366	0.035	0.046	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
15	PDB:1r1uC	0.121	0.521	6.545E-2	98	0.033	0.163	1r1uC.pdb.gz
16	PDB:7jppE	0.136	0.159	6.545E-2	406	0.039	0.047	7jppE.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
17	PDB:2nyxB	0.135	0.387	8.430E-2	147	0.010	0.034	2nyxB.pdb.gz
18	PDB:6mzlA	0.122	0.126	8.430E-2	472	0.027	0.028	6mzlA.pdb.gz
19	PDB:7a6hO	0.118	0.114	9.567E-2	512	0.020	0.020	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
20	PDB:4etsB	0.120	0.343	1.157E-1	149	0.020	0.067	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00409	0.0	1013	490	1.000	1.000	FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3 PE=1 SV=1
2	Q499D0	0.0	793	457	0.888	0.952	FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus OX=10090 GN=Foxn3 PE=1 SV=1
3	P32314	3.01e-100	309	431	0.445	0.506	FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens OX=9606 GN=FOXN2 PE=1 SV=3
4	E9Q7L6	1.91e-91	286	429	0.420	0.480	E9Q7L6_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=1 SV=1
5	Q8BSS2	1.28e-64	210	211	0.231	0.536	Q8BSS2_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=2 SV=1
6	E9PYQ6	2.96e-48	167	208	0.192	0.452	E9PYQ6_MOUSE Forkhead box N2 OS=Mus musculus OX=10090 GN=Foxn2 PE=4 SV=1
7	Q9U1H1	8.53e-43	149	120	0.145	0.592	Q9U1H1_DROME Checkpoint suppressor homologue (Fragment) OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=2 SV=1
8	M9PDZ5	6.90e-41	159	1267	0.153	0.059	M9PDZ5_DROME Checkpoint suppressor 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=1
9	Q9W3Q5	7.10e-41	159	1268	0.153	0.059	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
10	D4A1T1	5.26e-27	117	660	0.110	0.082	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
11	A0A8I6GMI6	5.90e-27	116	648	0.110	0.083	A0A8I6GMI6_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=1
12	O15353	7.28e-27	116	648	0.110	0.083	FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens OX=9606 GN=FOXN1 PE=1 SV=1
13	Q61575	7.62e-27	116	648	0.106	0.080	FOXN1_MOUSE Forkhead box protein N1 OS=Mus musculus OX=10090 GN=Foxn1 PE=1 SV=1
14	A2BGM5	1.89e-26	114	550	0.108	0.096	FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio OX=7955 GN=foxn4 PE=1 SV=1
15	F1R9K2	2.09e-26	114	565	0.102	0.088	F1R9K2_DANRE Forkhead box N1 OS=Danio rerio OX=7955 GN=nude PE=4 SV=1
16	Q7ZTC0	2.33e-26	114	565	0.102	0.088	Q7ZTC0_DANRE Forkhead box protein N1 OS=Danio rerio OX=7955 GN=whnb PE=2 SV=1
17	Q96NZ1	1.94e-25	111	517	0.100	0.095	FOXN4_HUMAN Forkhead box protein N4 OS=Homo sapiens OX=9606 GN=FOXN4 PE=1 SV=2
18	Q8K3Q3	2.45e-25	111	521	0.100	0.094	FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus OX=10090 GN=Foxn4 PE=1 SV=1
19	Q61660	9.89e-25	108	421	0.131	0.152	FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus OX=10090 GN=Foxj1 PE=1 SV=2
20	Q92949	1.36e-24	107	421	0.108	0.126	FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens OX=9606 GN=FOXJ1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.7e-31	119.5	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378402	0.943	Paired amphipathic helix protein Sin3a
2	9606.ENSP00000261531	0.872	SNW domain-containing protein 1
3	9606.ENSP00000337088	0.853	Menin
4	9606.ENSP00000343741	0.676	Serine/threonine-protein kinase ATR
5	9606.ENSP00000357073	0.660	Protein turtle homolog A
6	9606.ENSP00000398273	0.654	Transcription factor SOX-5
7	9606.ENSP00000302967	0.600	Histone deacetylase 3
8	9606.ENSP00000322568	0.583	Transcription factor SOX-11
9	9606.ENSP00000216862	0.581	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
10	9606.ENSP00000362649	0.580	Histone deacetylase 1
11	9606.ENSP00000284995	0.579	tRNA-splicing endonuclease subunit Sen2
12	9606.ENSP00000332296	0.571	Retinoic acid receptor beta
13	9606.ENSP00000216727	0.567	Polyadenylate-binding protein 2
14	9606.ENSP00000331698	0.537	ATP-sensitive inward rectifier potassium channel 15
15	9606.ENSP00000265372	0.522	cAMP responsive element modulator
16	9606.ENSP00000212015	0.511	NAD-dependent protein deacetylase sirtuin-1
17	9606.ENSP00000326267	0.508	EF-hand calcium-binding domain-containing protein 11
18	9606.ENSP00000366330	0.508	Krueppel-like factor 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.996	sequence-specific DNA binding
GO:0140110	0.960	transcription regulator activity
GO:1990837	0.960	sequence-specific double-stranded DNA binding
GO:0003700	0.924	DNA-binding transcription factor activity
GO:0000976	0.913	transcription cis-regulatory region binding
GO:0000981	0.522	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.311	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.981	regulation of metabolic process
GO:0050896	0.965	response to stimulus
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0010468	0.936	regulation of gene expression
GO:0019219	0.918	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.901	regulation of macromolecule biosynthetic process
GO:0051252	0.898	regulation of RNA metabolic process
GO:0031326	0.897	regulation of cellular biosynthetic process
GO:0006355	0.894	regulation of DNA-templated transcription
GO:0048519	0.868	negative regulation of biological process
GO:0048523	0.780	negative regulation of cellular process
GO:0010605	0.711	negative regulation of macromolecule metabolic process
GO:0045934	0.710	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.678	negative regulation of RNA metabolic process
GO:0045892	0.667	negative regulation of DNA-templated transcription
GO:0051716	0.664	cellular response to stimulus
GO:0007154	0.629	cell communication
GO:0032502	0.609	developmental process
GO:0032501	0.575	multicellular organismal process
GO:0048518	0.560	positive regulation of biological process
GO:0048856	0.559	anatomical structure development
GO:0048522	0.505	positive regulation of cellular process
GO:0007165	0.478	signal transduction
GO:0009893	0.467	positive regulation of metabolic process
GO:0051173	0.434	positive regulation of nitrogen compound metabolic process
GO:0006357	0.434	regulation of transcription by RNA polymerase II
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0010604	0.421	positive regulation of macromolecule metabolic process
GO:0045935	0.387	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.380	positive regulation of macromolecule biosynthetic process
GO:0048513	0.375	animal organ development
GO:0007275	0.374	multicellular organism development
GO:0031328	0.359	positive regulation of cellular biosynthetic process
GO:0071704	0.339	organic substance metabolic process
GO:0006950	0.328	response to stress
GO:0045893	0.327	positive regulation of DNA-templated transcription
GO:0045944	0.301	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.957	nucleoplasm
GO:0005737	0.625	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]