StarFunc result for job id O00410

User Input

>input (1097 residues)
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQ
MAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNL
IDEDGNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQC
MQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAVNDSCYQNDDSVLKSL
VEIADTVPKYLRPHLEATLQLSLKLCGDTSLNNMQRQLALEVIVTLSETAAAMLRKHTNI
VAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIK
EHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAAC
NAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIP
YLDNLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKH
IVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFNDMEDDDPQ
ISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFV
NLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDGVR
VAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIMHSFAKCIEVM
GDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILT
KVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASF
KYAEYFLRPMLQYVCDNSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADS
KTKENVNATENCISAVGKIMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLI
ESNHPIVLGPNNTNLPKIFSIIAEGEMHEAIKHEDPCAKRLANVVRQVQTSGGLWTECIA
QLSPEQQAAIQELLNSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6xu2A	0.959	0.964	0.000	1091	0.994	0.999	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
2	AFDB:O00410	1.000	1.000	0.000	1097	1.000	1.000	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
3	AFDB:O60518	0.966	0.959	8.545E-103	1105	0.790	0.785	O60518.pdb.gz	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
4	AFDB:Q9VN44	0.968	0.962	8.579E-82	1105	0.519	0.515	Q9VN44.pdb.gz	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
5	AFDB:Q93VS8	0.889	0.875	9.096E-60	1116	0.371	0.365	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
6	AFDB:Q5B163	0.903	0.904	4.226E-55	1095	0.345	0.346	Q5B163.pdb.gz	Q5B163_EMENI Importin beta-3 subunit, putative (AFU_orthologue AFUA_1G06790) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05717 PE=3 SV=1
7	AFDB:O74476	0.885	0.887	1.751E-54	1095	0.335	0.335	O74476.pdb.gz	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
8	AFDB:P32337	0.822	0.828	2.516E-48	1089	0.280	0.282	P32337.pdb.gz	IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSE1 PE=1 SV=2
9	PDB:3w3uA	0.806	0.853	3.687E-43	1030	0.262	0.279	3w3uA.pdb.gz
10	PDB:3w3zA	0.489	0.525	9.402E-43	1013	0.268	0.290	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
11	AFDB:Q8I3M5	0.774	0.758	3.688E-41	1123	0.253	0.247	Q8I3M5.pdb.gz	Q8I3M5_PLAF7 Karyopherin beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0524000 PE=4 SV=1
12	AFDB:Q5BBG0	0.679	0.681	8.241E-32	1093	0.181	0.182	Q5BBG0.pdb.gz	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
13	AFDB:Q8TEX9	0.683	0.691	2.587E-31	1081	0.208	0.211	Q8TEX9.pdb.gz	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
14	PDB:7unkA	0.642	0.668	3.350E-27	1047	0.198	0.207	7unkA.pdb.gz
15	PDB:4jlqA	0.415	0.510	8.597E-18	840	0.158	0.206	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:8dyoA	0.634	0.677	2.117E-17	1016	0.199	0.215	8dyoA.pdb.gz	Structure of IMPORTIN-4 bound to the H3-H4-ASF1 histone-histone chaperone complex.
17	PDB:3nd2A	0.507	0.619	2.204E-15	861	0.136	0.173	3nd2A.pdb.gz
18	PDB:1qgkA	0.564	0.687	2.445E-15	876	0.128	0.160	1qgkA.pdb.gz
19	PDB:2q5dB	0.559	0.700	2.098E-14	845	0.127	0.164	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
20	PDB:6bcuA	0.243	0.147	1.054E-12	2204	0.152	0.076	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00410	0.0	2278	1097	1.000	1.000	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
2	O60518	0.0	1839	1105	0.792	0.786	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
3	O74476	0.0	637	1095	0.341	0.342	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
4	Q28CS8	0.0	1123	574	0.479	0.916	Q28CS8_XENTR RAN binding protein 5 (Fragment) OS=Xenopus tropicalis OX=8364 GN=ranbp5 PE=2 SV=1
5	Q5B163	0.0	620	1095	0.353	0.353	Q5B163_EMENI Importin beta-3 subunit, putative (AFU_orthologue AFUA_1G06790) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05717 PE=3 SV=1
6	Q8BIV3	0.0	1825	1105	0.780	0.775	RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus OX=10090 GN=Ranbp6 PE=1 SV=3
7	Q8BKC5	0.0	2252	1097	0.983	0.983	IPO5_MOUSE Importin-5 OS=Mus musculus OX=10090 GN=Ipo5 PE=1 SV=3
8	Q93VS8	0.0	703	1116	0.379	0.373	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
9	Q960E2	0.0	847	712	0.353	0.544	Q960E2_DROME SD05186p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=2 SV=1
10	Q9VN44	0.0	1189	1105	0.521	0.517	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
11	P32337	7.57e-128	419	1089	0.283	0.285	IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSE1 PE=1 SV=2
12	Q8I3M5	4.57e-101	347	1123	0.252	0.246	Q8I3M5_PLAF7 Karyopherin beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0524000 PE=4 SV=1
13	O60100	4.23e-34	144	1067	0.212	0.218	IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap123 PE=3 SV=1
14	Q5BBG0	5.16e-34	144	1093	0.219	0.220	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
15	P40069	2.84e-33	142	1113	0.213	0.210	IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP123 PE=1 SV=1
16	Q8VI75	1.58e-24	113	1082	0.220	0.223	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
17	Q8H0U4	6.37e-23	108	891	0.136	0.167	TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana OX=3702 GN=TRN1 PE=1 SV=1
18	Q8TEX9	1.19e-21	104	1081	0.178	0.180	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
19	Q381F2	3.11e-11	70.5	1149	0.142	0.136	Q381F2_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8030 PE=4 SV=1
20	Q9FJD4	5.02e-10	66.2	870	0.127	0.160	IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana OX=3702 GN=KPNB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	0.79	21.1	Armadillo/beta-catenin-like repeat
2	PF12717 Cnd1	0.0033	28.9	non-SMC mitotic condensation complex subunit 1
3	PF11865 DUF3385	0.00047	31.6	Domain of unknown function (DUF3385)
4	PF02985 HEAT	6.6e-17	71.2	HEAT repeat
5	PF13646 HEAT_2	3.7e-16	70.6	HEAT repeats
6	PF13513 HEAT_EZ	1.9e-15	68.3	HEAT-like repeat
7	PF03130 HEAT_PBS	9.5	18.2	PBS lyase HEAT-like repeat
8	PF03810 IBN_N	0.17	23.2	Importin-beta N-terminal domain
9	PF18808 Importin_rep_4	4.7e-24	95.9	Importin repeat
10	PF18816 Importin_rep_5	5.8e-06	37.7	Importin repeat
11	PF18829 Importin_rep_6	3.4e-33	125.6	Importin repeat 6
12	PF14812 PBP1_TM	2.1e+02	13.7	Transmembrane domain of transglycosylase PBP1 at N-terminal
13	PF10363 RTP1_C1	18	16.9	Required for nuclear transport of RNA pol II C-terminus 1
14	PF12755 Vac14_Fab1_bd	1.7e-14	65.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446215	0.990	GTP-binding nuclear protein Ran
2	9606.ENSP00000354742	0.965	Importin-9
3	9606.ENSP00000262982	0.956	Exportin-2
4	9606.ENSP00000394791	0.956	Sentrin-specific protease 1
5	9606.ENSP00000369042	0.954	Importin-7
6	9606.ENSP00000384863	0.947	Exportin-1
7	9606.ENSP00000290158	0.934	Importin subunit beta-1
8	9606.ENSP00000386992	0.923	Importin-11
9	9606.ENSP00000357552	0.902	Importin subunit alpha-6
10	9606.ENSP00000336712	0.887	Transportin-1
11	9606.ENSP00000343701	0.884	Importin subunit alpha-5
12	9606.ENSP00000296577	0.880	ATP-binding cassette sub-family E member 1
13	9606.ENSP00000389103	0.854	60S ribosomal protein L23a
14	9606.ENSP00000471896	0.850	Interferon regulatory factor 3
15	9606.ENSP00000354125	0.839	Eukaryotic translation initiation factor 3 subunit B
16	9606.ENSP00000314029	0.821	Sentrin-specific protease 3
17	9606.ENSP00000316032	0.813	Nuclear pore complex protein Nup98-Nup96
18	9606.ENSP00000444136	0.808	DNA-directed RNA polymerase I subunit RPA2
19	9606.ENSP00000362728	0.807	Importin subunit alpha-7
20	9606.ENSP00000256079	0.803	Importin-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003676	0.911	nucleic acid binding
GO:0031267	0.576	small GTPase binding
GO:0030234	0.564	enzyme regulator activity
GO:0140142	0.481	nucleocytoplasmic carrier activity
GO:0003723	0.451	RNA binding
GO:0061608	0.400	nuclear import signal receptor activity
GO:0005095	0.372	GTPase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.985	biological regulation
GO:0050789	0.976	regulation of biological process
GO:0051179	0.960	localization
GO:0050794	0.959	regulation of cellular process
GO:0006913	0.938	nucleocytoplasmic transport
GO:0071705	0.936	nitrogen compound transport
GO:0008104	0.936	protein localization
GO:0071702	0.935	organic substance transport
GO:0015031	0.930	protein transport
GO:0034504	0.927	protein localization to nucleus
GO:0072594	0.927	establishment of protein localization to organelle
GO:0051170	0.925	import into nucleus
GO:0006606	0.924	protein import into nucleus
GO:0060255	0.669	regulation of macromolecule metabolic process
GO:0051171	0.650	regulation of nitrogen compound metabolic process
GO:0080090	0.641	regulation of primary metabolic process
GO:0031323	0.502	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005634	0.997	nucleus
GO:0012505	0.843	endomembrane system
GO:0032991	0.819	protein-containing complex
GO:0043233	0.616	organelle lumen
GO:0016020	0.540	membrane
GO:0005654	0.487	nucleoplasm
GO:0005829	0.310	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]