StarFunc result for job id O00411

User Input

>input (1230 residues)
MSALCWGRGAAGLKRALRPCGRPGLPGKEGTAGGVCGPRRSSSASPQEQDQDRRKDWGHV
ELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCG
RWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTR
QAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLP
LAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYA
AALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSL
PPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKP
TLPSKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYPFLCLLDEREVV
RMLLQVLQALPAQGESFTTLARELSARTFSRHVVQRQRVSGQVQALQNHYRKYLCLLASD
AEVPEPCLPRQYWEELGAPEALREQPWPLPVQMELGKLLAEMLVQATQMPCSLDKPHRSS
RLVPVLYHVYSFRNVQQIGILKPHPAYVQLLEKAAEPTLTFEAVDVPMLCPPLPWTSPHS
GAFLLSPTKLMRTVEGATQHQELLETCPPTALHGALDALTQLGNCAWRVNGRVLDLVLQL
FQAKGCPQLGVPAPPSEAPQPPEAHLPHSAAPARKAELRRELAHCQKVAREMHSLRAEAL
YRLSLAQHLRDRVFWLPHNMDFRGRTYPCPPHFNHLGSDVARALLEFAQGRPLGPHGLDW
LKIHLVNLTGLKKREPLRKRLAFAEEVMDDILDSADQPLTGRKWWMGAEEPWQTLACCME
VANAVRASDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVA
AQVEVFRRQDAQRGMRVAQVLEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELSDF
PQEFVWEASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEWVTPLGVPVIQ
PYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLDSSHMMLTALHCY
RKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILE
ASQLKETLQAVPKPGAFDLEQVKRSTYFFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3spaA	0.745	0.969	0.000	941	0.763	0.998	3spaA.pdb.gz	Structure of human mitochondrial RNA polymerase
2	PDB:6erpA	0.788	0.956	0.000	1011	0.820	0.998	6erpA.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
3	PDB:7pzpA	0.783	0.969	0.000	990	0.805	1.000	7pzpA.pdb.gz
4	AFDB:O00411	1.000	1.000	0.000	1230	1.000	1.000	O00411.pdb.gz	RPOM_HUMAN DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2
5	AFDB:Q8BKF1	0.867	0.883	0.000	1207	0.662	0.674	Q8BKF1.pdb.gz	RPOM_MOUSE DNA-directed RNA polymerase, mitochondrial OS=Mus musculus OX=10090 GN=Polrmt PE=1 SV=1
6	AFDB:Q9VPW4	0.774	0.699	5.556E-86	1369	0.387	0.348	Q9VPW4.pdb.gz	Q9VPW4_DROME DNA-directed RNA polymerase OS=Drosophila melanogaster OX=7227 GN=PolrMT PE=2 SV=1
7	AFDB:Q95NZ8	0.445	0.572	9.166E-54	950	0.240	0.311	Q95NZ8.pdb.gz	Q95NZ8_DICDI DNA-directed RNA polymerase OS=Dictyostelium discoideum OX=44689 GN=rpmA PE=2 SV=1
8	AFDB:Q8VWF8	0.571	0.684	1.084E-53	1020	0.262	0.316	Q8VWF8.pdb.gz	RPOT2_NICSY DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Nicotiana sylvestris OX=4096 GN=RPOT2 PE=2 SV=2
9	AFDB:F4KB75	0.560	0.652	3.666E-53	1051	0.270	0.316	F4KB75.pdb.gz	F4KB75_ARATH DNA-directed RNA polymerase OS=Arabidopsis thaliana OX=3702 GN=At5g15700 PE=1 SV=1
10	AFDB:F4I0I3	0.581	0.722	1.595E-52	983	0.229	0.287	F4I0I3.pdb.gz	F4I0I3_ARATH DNA-directed RNA polymerase OS=Arabidopsis thaliana OX=3702 GN=MGP3 PE=1 SV=1
11	AFDB:P69242	0.559	0.698	9.309E-52	977	0.240	0.302	P69242.pdb.gz	RPOT3_NICSY DNA-directed RNA polymerase 3, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=RPOT3 PE=2 SV=1
12	AFDB:O24600	0.570	0.701	1.101E-51	993	0.237	0.294	O24600.pdb.gz	RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPOT3 PE=2 SV=1
13	AFDB:Q93Y94	0.567	0.691	2.446E-51	1002	0.238	0.292	Q93Y94.pdb.gz	RPOT1_NICSY DNA-directed RNA polymerase 1, mitochondrial OS=Nicotiana sylvestris OX=4096 GN=RPOT1 PE=2 SV=1
14	PDB:6ymwA	0.545	0.722	4.252E-49	913	0.233	0.313	6ymwA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
15	PDB:6ymvA	0.549	0.749	4.898E-47	887	0.228	0.317	6ymvA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
16	PDB:1mswD	0.419	0.586	1.053E-34	863	0.174	0.248	1mswD.pdb.gz	Structural Basis for the Transition from Initiation to Elongation Transcription in T7 RNA Polymerase
17	PDB:1s76D	0.435	0.635	2.439E-34	829	0.170	0.252	1s76D.pdb.gz	The structural mechanism of translocation and helicase activity in T7 RNA polymerase.
18	PDB:1aroP	0.476	0.727	6.664E-29	774	0.163	0.258	1aroP.pdb.gz
19	PDB:4rnpA	0.512	0.774	1.014E-28	780	0.163	0.258	4rnpA.pdb.gz
20	PDB:2ajqA	0.119	0.195	2.431E-2	704	0.038	0.067	2ajqA.pdb.gz	Structure of replicative DNA polymerase provides insigts into the mechanisms for processivity, frameshifting and editing

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EMH3	0.0	689	347	0.282	1.000	K7EMH3_HUMAN RNA polymerase mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=4
2	O00411	0.0	2523	1230	1.000	1.000	RPOM_HUMAN DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=POLRMT PE=1 SV=2
3	Q8BKF1	0.0	1599	1207	0.667	0.680	RPOM_MOUSE DNA-directed RNA polymerase, mitochondrial OS=Mus musculus OX=10090 GN=Polrmt PE=1 SV=1
4	Q9VPW4	0.0	815	1369	0.369	0.332	Q9VPW4_DROME DNA-directed RNA polymerase OS=Drosophila melanogaster OX=7227 GN=PolrMT PE=2 SV=1
5	Q95NZ8	1.08e-163	514	950	0.222	0.287	Q95NZ8_DICDI DNA-directed RNA polymerase OS=Dictyostelium discoideum OX=44689 GN=rpmA PE=2 SV=1
6	F4KB75	1.43e-159	506	1051	0.220	0.257	F4KB75_ARATH DNA-directed RNA polymerase OS=Arabidopsis thaliana OX=3702 GN=At5g15700 PE=1 SV=1
7	Q8VWF8	2.02e-156	497	1020	0.231	0.278	RPOT2_NICSY DNA-directed RNA polymerase 2, chloroplastic/mitochondrial OS=Nicotiana sylvestris OX=4096 GN=RPOT2 PE=2 SV=2
8	O24600	2.83e-152	485	993	0.224	0.278	RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPOT3 PE=2 SV=1
9	F4I0I3	3.15e-150	479	983	0.218	0.273	F4I0I3_ARATH DNA-directed RNA polymerase OS=Arabidopsis thaliana OX=3702 GN=MGP3 PE=1 SV=1
10	P13433	8.33e-150	488	1351	0.216	0.197	RPOM_YEAST DNA-directed RNA polymerase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO41 PE=1 SV=2
11	Q93Y94	3.23e-149	477	1002	0.219	0.268	RPOT1_NICSY DNA-directed RNA polymerase 1, mitochondrial OS=Nicotiana sylvestris OX=4096 GN=RPOT1 PE=2 SV=1
12	O13993	3.23e-147	476	1154	0.213	0.227	RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpo41 PE=3 SV=2
13	P69242	3.95e-147	471	977	0.216	0.272	RPOT3_NICSY DNA-directed RNA polymerase 3, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=RPOT3 PE=2 SV=1
14	Q385J0	6.68e-83	298	1274	0.149	0.144	Q385J0_TRYB2 DNA-directed RNA polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3530 PE=3 SV=1
15	Q95WT2	7.75e-82	295	1274	0.147	0.142	Q95WT2_9TRYP DNA-directed RNA polymerase OS=Trypanosoma brucei OX=5691 GN=MTRNAP PE=3 SV=1
16	P07659	2.57e-71	259	884	0.176	0.245	RPOL_BPT3 DNA-directed RNA polymerase OS=Enterobacteria phage T3 OX=10759 GN=1 PE=3 SV=1
17	P00573	3.41e-64	238	883	0.172	0.239	RPOL_BPT7 T7 RNA polymerase OS=Escherichia phage T7 OX=10760 GN=1 PE=1 SV=2
18	Q8IIB0	5.86e-54	209	1531	0.093	0.074	Q8IIB0_PLAF7 DNA-directed RNA polymerase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1125300 PE=3 SV=1
19	Q9ZU27	0.023	41.2	650	0.022	0.042	PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51965 PE=2 SV=1
20	Q9FLJ6	0.038	40.4	487	0.014	0.035	PP439_ARATH Pentatricopeptide repeat-containing protein At5g61370, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g61370 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04751 DUF615	54	15.2	Protein of unknown function (DUF615)
2	PF13812 PPR_3	1.1e+02	14.3	Pentatricopeptide repeat domain
3	PF07624 PSD2	3.9	18.6	Protein of unknown function (DUF1585)
4	PF00940 RNA_pol	1.4e-156	533.3	DNA-dependent RNA polymerase
5	PF14700 RPOL_N	6.6e-51	185.3	DNA-directed RNA polymerase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355471	0.999	Dimethyladenosine transferase 2, mitochondrial
2	9606.ENSP00000420588	0.999	Transcription factor A, mitochondrial
3	9606.ENSP00000356134	0.988	Dimethyladenosine transferase 1, mitochondrial
4	9606.ENSP00000333837	0.986	39S ribosomal protein L12, mitochondrial
5	9606.ENSP00000462963	0.985	Transcription elongation factor, mitochondrial
6	9606.ENSP00000220429	0.950	GA-binding protein subunit beta-1
7	9606.ENSP00000346886	0.916	GA-binding protein alpha chain
8	9606.ENSP00000309595	0.896	Twinkle protein, mitochondrial
9	9606.ENSP00000419665	0.892	Single-stranded DNA-binding protein, mitochondrial
10	9606.ENSP00000260665	0.860	Leucine-rich PPR motif-containing protein, mitochondrial
11	9606.ENSP00000268124	0.850	DNA polymerase subunit gamma-1
12	9606.ENSP00000287025	0.832	Transcription termination factor 3, mitochondrial
13	9606.ENSP00000248643	0.818	Transcription termination factor 1, mitochondrial
14	9606.ENSP00000352678	0.812	ATP-dependent RNA helicase SUPV3L1, mitochondrial
15	9606.ENSP00000292478	0.788	Pentatricopeptide repeat-containing protein 1, mitochondrial
16	9606.ENSP00000400168	0.782	ATP5J2-PTCD1 readthrough
17	9606.ENSP00000405620	0.781	Putative ATP-dependent RNA helicase DHX30
18	9606.ENSP00000354632	0.775	ATP synthase subunit a
19	9606.ENSP00000366939	0.771	Mitochondrial genome maintenance exonuclease 1
20	9606.ENSP00000292363	0.769	E3 ubiquitin-protein ligase RNF126

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0003896	0.997	DNA primase activity
GO:0004527	0.994	exonuclease activity
GO:0003723	0.993	RNA binding
GO:0000175	0.976	3'-5'-RNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0000959	0.991	mitochondrial RNA metabolic process
GO:0140053	0.990	mitochondrial gene expression
GO:0006351	0.989	DNA-templated transcription
GO:0006352	0.864	DNA-templated transcription initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0032991	0.996	protein-containing complex
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005759	0.922	mitochondrial matrix
GO:0005634	0.744	nucleus
GO:0042645	0.646	mitochondrial nucleoid
GO:0031981	0.375	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.101	0.997	DNA primase DnaG.
EC:3.1.-.-	0.994	Acting on ester bonds.
EC:3.1.13.-	0.976	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]