StarFunc result for job id O00418

User Input

>input (725 residues)
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00418	1.000	1.000	0.000	725	1.000	1.000	O00418.pdb.gz	EF2K_HUMAN Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2
2	AFDB:Q6DGE0	0.725	0.745	7.317E-80	706	0.639	0.656	Q6DGE0.pdb.gz	Q6DGE0_DANRE Eukaryotic elongation factor 2 kinase OS=Danio rerio OX=7955 GN=cb365 PE=2 SV=1
3	AFDB:O01991	0.654	0.619	3.327E-55	768	0.390	0.368	O01991.pdb.gz	EF2K_CAEEL Eukaryotic elongation factor 2 kinase OS=Caenorhabditis elegans OX=6239 GN=efk-1 PE=1 SV=1
4	AFDB:Q54SF9	0.278	0.216	8.759E-20	941	0.159	0.122	Q54SF9.pdb.gz	MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum OX=44689 GN=mhkD PE=3 SV=1
5	AFDB:Q8MY12	0.276	0.257	7.897E-18	780	0.157	0.146	Q8MY12.pdb.gz	MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum OX=44689 GN=mhkC PE=1 SV=1
6	AFDB:P90648	0.264	0.262	3.214E-17	732	0.154	0.153	P90648.pdb.gz	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
7	PDB:4bwrA	0.160	0.234	3.503E-6	467	0.068	0.105	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
8	PDB:7mqzA	0.182	0.543	3.652E-4	209	0.052	0.182	7mqzA.pdb.gz
9	PDB:1klxA	0.123	0.567	3.552E-3	133	0.029	0.158	1klxA.pdb.gz
10	AFDB:Q8IRI5	0.068	0.064	6.329E-3	804	0.124	0.112	Q8IRI5.pdb.gz	Q8IRI5_DROME Trio, isoform D OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
11	PDB:1qqeA	0.152	0.355	7.341E-3	281	0.046	0.117	1qqeA.pdb.gz
12	PDB:7qe7J	0.132	0.176	1.191E-2	510	0.039	0.055	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
13	PDB:5w5iC	0.146	0.216	1.312E-2	436	0.052	0.087	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
14	AFDB:Q385L2	0.098	0.096	1.441E-2	752	0.059	0.057	Q385L2.pdb.gz	Q385L2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3260 PE=4 SV=1
15	AFDB:P38213	0.125	0.123	1.588E-2	736	0.072	0.071	P38213.pdb.gz	DSF2_YEAST Protein DSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSF2 PE=1 SV=2
16	PDB:5udkA	0.154	0.224	2.029E-2	461	0.051	0.080	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
17	PDB:5yqgC	0.096	0.240	2.129E-2	237	0.039	0.118	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
18	PDB:2fi7A	0.140	0.365	2.235E-2	223	0.033	0.108	2fi7A.pdb.gz
19	PDB:6bq1B	0.120	0.120	2.462E-2	728	0.065	0.065	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
20	AFDB:B0BF33	0.082	0.075	4.180E-2	815	0.083	0.074	B0BF33.pdb.gz	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F318	0.0	888	744	0.639	0.622	E7F318_DANRE Eukaryotic elongation factor 2 kinase OS=Danio rerio OX=7955 GN=cb365 PE=3 SV=1
2	O00418	0.0	1517	725	1.000	1.000	EF2K_HUMAN Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2
3	O08796	0.0	1333	724	0.899	0.901	EF2K_MOUSE Eukaryotic elongation factor 2 kinase OS=Mus musculus OX=10090 GN=Eef2k PE=1 SV=1
4	P70531	0.0	1327	724	0.901	0.902	EF2K_RAT Eukaryotic elongation factor 2 kinase OS=Rattus norvegicus OX=10116 GN=Eef2k PE=1 SV=1
5	Q6DGE0	0.0	884	706	0.628	0.644	Q6DGE0_DANRE Eukaryotic elongation factor 2 kinase OS=Danio rerio OX=7955 GN=cb365 PE=2 SV=1
6	O01991	7.14e-145	444	768	0.394	0.372	EF2K_CAEEL Eukaryotic elongation factor 2 kinase OS=Caenorhabditis elegans OX=6239 GN=efk-1 PE=1 SV=1
7	Q54DK4	5.36e-56	210	1352	0.145	0.078	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
8	P90648	3.48e-55	204	732	0.145	0.143	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
9	Q54SF9	1.06e-42	169	941	0.132	0.102	MHCKD_DICDI Myosin heavy chain kinase D OS=Dictyostelium discoideum OX=44689 GN=mhkD PE=3 SV=1
10	Q8MY12	2.91e-42	166	780	0.124	0.115	MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum OX=44689 GN=mhkC PE=1 SV=1
11	P42527	1.15e-41	166	1146	0.124	0.079	MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mhkA PE=1 SV=2
12	Q6B9X6	3.55e-25	113	625	0.099	0.115	VWKA_DICDI Alpha-protein kinase vwkA OS=Dictyostelium discoideum OX=44689 GN=vwkA PE=1 SV=1
13	Q9CXB8	2.45e-16	85.9	1231	0.092	0.054	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
14	Q96QP1	8.83e-14	77.8	1244	0.081	0.047	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
15	Q9BX84	7.29e-11	68.6	2022	0.050	0.018	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
16	Q8CIR4	8.72e-11	68.2	2028	0.073	0.026	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
17	Q563W7	3.22e-10	66.2	1774	0.054	0.022	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
18	Q923J1	2.70e-09	63.2	1863	0.048	0.019	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
19	Q925B3	2.84e-09	63.2	1862	0.048	0.019	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
20	Q96QT4	3.20e-09	63.2	1865	0.048	0.019	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02816 Alpha_kinase	2.5e-56	202.3	Alpha-kinase family
2	PF08238 Sel1	0.001	30.9	Sel1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307940	0.992	Elongation factor 2
2	9606.ENSP00000225577	0.978	Ribosomal protein S6 kinase beta-1
3	9606.ENSP00000211287	0.931	Mitogen-activated protein kinase 13
4	9606.ENSP00000408695	0.868	Protein kinase C alpha type
5	9606.ENSP00000265094	0.861	F-box/WD repeat-containing protein 11
6	9606.ENSP00000346148	0.853	5'-AMP-activated protein kinase catalytic subunit alpha-1
7	9606.ENSP00000360290	0.848	5'-AMP-activated protein kinase catalytic subunit alpha-2
8	9606.ENSP00000263431	0.839	Protein kinase C gamma type
9	9606.ENSP00000305355	0.838	Protein kinase C beta type
10	9606.ENSP00000272298	0.826	Calmodulin 2 (phosphorylase kinase, delta)
11	9606.ENSP00000291295	0.826	Calmodulin 3 (phosphorylase kinase, delta)
12	9606.ENSP00000349467	0.826	Calmodulin-1
13	9606.ENSP00000287878	0.812	5'-AMP-activated protein kinase subunit gamma-2
14	9606.ENSP00000229328	0.808	5'-AMP-activated protein kinase subunit beta-1
15	9606.ENSP00000254101	0.807	5'-AMP-activated protein kinase subunit beta-2
16	9606.ENSP00000397133	0.804	5'-AMP-activated protein kinase subunit gamma-3
17	9606.ENSP00000323867	0.802	5'-AMP-activated protein kinase subunit gamma-1
18	9606.ENSP00000388806	0.723	Eukaryotic translation initiation factor 4B
19	9606.ENSP00000359206	0.720	F-box/WD repeat-containing protein 1A
20	9606.ENSP00000435412	0.677	Ribosomal protein S6 kinase alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	1.000	calmodulin binding
GO:0008135	1.000	translation factor activity, RNA binding
GO:0004686	1.000	elongation factor-2 kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0019538	0.980	protein metabolic process
GO:0050789	0.977	regulation of biological process
GO:0006414	0.972	translational elongation
GO:0019222	0.962	regulation of metabolic process
GO:0050794	0.954	regulation of cellular process
GO:0060255	0.933	regulation of macromolecule metabolic process
GO:0051171	0.918	regulation of nitrogen compound metabolic process
GO:0050896	0.879	response to stimulus
GO:0031323	0.878	regulation of cellular metabolic process
GO:0048518	0.843	positive regulation of biological process
GO:0006468	0.815	protein phosphorylation
GO:0080090	0.782	regulation of primary metabolic process
GO:0051246	0.726	regulation of protein metabolic process
GO:0051716	0.712	cellular response to stimulus
GO:0048522	0.496	positive regulation of cellular process
GO:0010468	0.472	regulation of gene expression
GO:0009893	0.412	positive regulation of metabolic process
GO:0048519	0.411	negative regulation of biological process
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0007154	0.374	cell communication
GO:0048523	0.372	negative regulation of cellular process
GO:0023052	0.351	signaling
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0010556	0.315	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.996	organelle
GO:0005829	0.995	cytosol
GO:0043227	0.940	membrane-bounded organelle
GO:0032991	0.912	protein-containing complex
GO:0005634	0.886	nucleus
GO:0070013	0.606	intracellular organelle lumen
GO:0031981	0.603	nuclear lumen
GO:0042995	0.543	cell projection
GO:0005654	0.515	nucleoplasm
GO:0120025	0.506	plasma membrane bounded cell projection
GO:0045202	0.481	synapse
GO:0098794	0.425	postsynapse
GO:0012505	0.384	endomembrane system
GO:0043005	0.381	neuron projection
GO:0016020	0.340	membrane
GO:0098984	0.334	neuron to neuron synapse
GO:0099572	0.328	postsynaptic specialization
GO:0036477	0.325	somatodendritic compartment
GO:0014069	0.318	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21436	1.000	[translation elongation factor 2] + ATP = [translation elongation factor 2]-phosphate + ADP + H(+)
EC:2.7.11.20	1.000	[elongation factor 2] kinase.

[back to server]