StarFunc result for job id O00421

User Input

>input (344 residues)
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00421	1.000	1.000	1.189E-44	344	1.000	1.000	O00421.pdb.gz	CCRL2_HUMAN C-C chemokine receptor-like 2 OS=Homo sapiens OX=9606 GN=CCRL2 PE=1 SV=2
2	AFDB:O35457	0.791	0.756	2.533E-23	360	0.512	0.489	O35457.pdb.gz	CCRL2_MOUSE C-C chemokine receptor-like 2 OS=Mus musculus OX=10090 GN=Ccrl2 PE=1 SV=2
3	AFDB:P51681	0.784	0.767	9.946E-19	352	0.398	0.389	P51681.pdb.gz	CCR5_HUMAN C-C chemokine receptor type 5 OS=Homo sapiens OX=9606 GN=CCR5 PE=1 SV=1
4	AFDB:O08556	0.786	0.765	2.533E-18	354	0.398	0.387	O08556.pdb.gz	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
5	AFDB:A1LPE5	0.792	0.768	2.757E-18	355	0.407	0.394	A1LPE5.pdb.gz
6	AFDB:P41597	0.772	0.712	4.590E-18	374	0.378	0.348	P41597.pdb.gz	CCR2_HUMAN C-C chemokine receptor type 2 OS=Homo sapiens OX=9606 GN=CCR2 PE=1 SV=1
7	AFDB:O55193	0.770	0.712	6.180E-18	373	0.381	0.351	O55193.pdb.gz	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
8	AFDB:P32246	0.778	0.755	1.713E-17	355	0.410	0.397	P32246.pdb.gz	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
9	AFDB:O54814	0.787	0.756	4.007E-17	359	0.387	0.370	O54814.pdb.gz	CCR3_RAT C-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Ccr3 PE=2 SV=1
10	AFDB:G3V7C3	0.773	0.740	1.560E-16	360	0.328	0.314	G3V7C3.pdb.gz	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
11	PDB:7f1tA	0.741	0.608	8.174E-16	423	0.381	0.310	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
12	PDB:7vl9R	0.711	0.802	4.107E-15	302	0.381	0.434	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
13	PDB:7f1qR	0.716	0.673	4.471E-15	367	0.372	0.349	7f1qR.pdb.gz
14	PDB:7x9yR	0.691	0.801	2.663E-14	293	0.358	0.420	7x9yR.pdb.gz
15	PDB:7f1rR	0.696	0.729	3.585E-14	327	0.366	0.385	7f1rR.pdb.gz
16	PDB:5t1aA	0.716	0.559	2.755E-13	445	0.355	0.274	5t1aA.pdb.gz	Structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists.
17	PDB:7eibA	0.688	0.794	1.912E-10	295	0.224	0.261	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
18	PDB:8ef5M	0.626	0.736	1.912E-10	288	0.203	0.243	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
19	PDB:7sk8A	0.710	0.791	2.364E-10	306	0.209	0.235	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
20	PDB:7rkfR	0.690	0.791	2.924E-10	296	0.203	0.236	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00421	0.0	711	344	1.000	1.000	CCRL2_HUMAN C-C chemokine receptor-like 2 OS=Homo sapiens OX=9606 GN=CCRL2 PE=1 SV=2
2	O35457	8.69e-111	328	360	0.520	0.497	CCRL2_MOUSE C-C chemokine receptor-like 2 OS=Mus musculus OX=10090 GN=Ccrl2 PE=1 SV=2
3	P51682	6.16e-79	247	354	0.404	0.393	CCR5_MOUSE C-C chemokine receptor type 5 OS=Mus musculus OX=10090 GN=Ccr5 PE=2 SV=3
4	P41597	1.10e-78	247	374	0.384	0.353	CCR2_HUMAN C-C chemokine receptor type 2 OS=Homo sapiens OX=9606 GN=CCR2 PE=1 SV=1
5	P32246	1.51e-78	246	355	0.398	0.386	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
6	O55193	3.50e-78	246	373	0.369	0.340	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
7	P51683	2.42e-77	243	373	0.360	0.332	CCR2_MOUSE C-C chemokine receptor type 2 OS=Mus musculus OX=10090 GN=Ccr2 PE=1 SV=2
8	P51681	2.73e-75	238	352	0.384	0.375	CCR5_HUMAN C-C chemokine receptor type 5 OS=Homo sapiens OX=9606 GN=CCR5 PE=1 SV=1
9	O08556	4.23e-75	237	354	0.372	0.362	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
10	O54814	4.95e-75	237	359	0.404	0.387	CCR3_RAT C-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Ccr3 PE=2 SV=1
11	P51678	1.12e-74	236	359	0.404	0.387	CCR3_MOUSE Probable C-C chemokine receptor type 3 OS=Mus musculus OX=10090 GN=Ccr3 PE=2 SV=2
12	P51677	5.67e-72	229	355	0.416	0.403	CCR3_HUMAN C-C chemokine receptor type 3 OS=Homo sapiens OX=9606 GN=CCR3 PE=1 SV=1
13	P51675	9.64e-67	216	355	0.372	0.361	CCR1_MOUSE C-C chemokine receptor type 1 OS=Mus musculus OX=10090 GN=Ccr1 PE=2 SV=2
14	Q91ZH4	2.90e-60	199	360	0.337	0.322	Q91ZH4_RAT C-C chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=2 SV=2
15	G3V7C3	4.45e-60	198	360	0.334	0.319	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
16	A0N0Q1	2.08e-59	197	360	0.346	0.331	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
17	P51679	2.08e-59	197	360	0.346	0.331	CCR4_HUMAN C-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=1 SV=1
18	P51680	1.51e-57	192	360	0.317	0.303	CCR4_MOUSE C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2
19	F1QYD4	2.64e-54	183	358	0.291	0.279	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
20	P56484	3.27e-54	183	353	0.297	0.289	CCR8_MOUSE C-C chemokine receptor type 8 OS=Mus musculus OX=10090 GN=Ccr8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.4e-29	114.8	7 transmembrane receptor (rhodopsin family)
2	PF12530 DUF3730	1.2e+02	13.6	Focadhesin/RST1, DUF3730

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308815	0.988	C-C motif chemokine 19
2	9606.ENSP00000418009	0.986	Retinoic acid receptor responder protein 2
3	9606.ENSP00000351671	0.943	C-C motif chemokine 20
4	9606.ENSP00000011653	0.821	T-cell surface glycoprotein CD4
5	9606.ENSP00000344192	0.806	Interleukin-17A
6	9606.ENSP00000474412	0.743	C-C motif chemokine 5
7	9606.ENSP00000259607	0.733	C-C motif chemokine 21
8	9606.ENSP00000321345	0.733	Interleukin-23 receptor
9	9606.ENSP00000177694	0.731	T-box transcription factor TBX21
10	9606.ENSP00000229402	0.730	Killer cell lectin-like receptor subfamily B member 1
11	9606.ENSP00000365380	0.724	Forkhead box protein P3
12	9606.ENSP00000398698	0.723	Tumor necrosis factor
13	9606.ENSP00000263341	0.721	Interleukin-1 beta
14	9606.ENSP00000327025	0.710	Nuclear receptor ROR-gamma
15	9606.ENSP00000386559	0.710	T-cell surface glycoprotein CD8 alpha chain
16	9606.ENSP00000225831	0.707	C-C motif chemokine 2
17	9606.ENSP00000306512	0.704	Interleukin-8
18	9606.ENSP00000337432	0.702	Interleukin-17F
19	9606.ENSP00000306157	0.700	Interleukin-7 receptor subunit alpha
20	9606.ENSP00000236147	0.688	L-selectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042379	0.999	chemokine receptor binding
GO:0008528	0.996	G protein-coupled peptide receptor activity
GO:0140375	0.865	immune receptor activity
GO:0001637	0.862	G protein-coupled chemoattractant receptor activity
GO:0004896	0.848	cytokine receptor activity
GO:0004950	0.792	chemokine receptor activity
GO:0048020	0.687	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0007165	0.984	signal transduction
GO:0042221	0.980	response to chemical
GO:0006935	0.835	chemotaxis
GO:0007186	0.675	G protein-coupled receptor signaling pathway
GO:0048518	0.435	positive regulation of biological process
GO:0002376	0.419	immune system process
GO:0006950	0.339	response to stress
GO:0006952	0.331	defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.567	organelle
GO:0043227	0.556	membrane-bounded organelle
GO:0005622	0.540	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]