StarFunc result for job id O00425

User Input

>input (579 residues)
MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGK
IELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00425	1.000	1.000	0.000	579	1.000	1.000	O00425.pdb.gz	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
2	AFDB:O73932	0.747	0.729	5.218E-99	594	0.834	0.813	O73932.pdb.gz	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
3	AFDB:Q9PW80	0.713	0.710	8.453E-96	582	0.777	0.773	Q9PW80.pdb.gz	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
4	AFDB:Q08CK7	0.775	0.752	4.421E-94	598	0.744	0.721	Q08CK7.pdb.gz	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
5	AFDB:O88477	0.667	0.669	6.812E-93	577	0.722	0.724	O88477.pdb.gz	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
6	AFDB:Q9Y6M1	0.802	0.777	6.703E-89	599	0.670	0.648	Q9Y6M1.pdb.gz	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
7	AFDB:M9NF14	0.380	0.355	5.333E-54	638	0.349	0.317	M9NF14.pdb.gz	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
8	AFDB:Q0WNX3	0.317	0.332	5.350E-26	548	0.162	0.172	Q0WNX3.pdb.gz	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1
9	AFDB:A0A178WDD2	0.257	0.241	2.040E-25	621	0.157	0.147	A0A178WDD2.pdb.gz	A0A178WDD2_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At1g51580 PE=1 SV=1
10	AFDB:Q17936	0.243	0.231	8.243E-25	611	0.136	0.129	Q17936.pdb.gz	Q17936_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fubl-1 PE=1 SV=1
11	PDB:5vsuA	0.123	0.182	6.765E-11	387	0.107	0.160	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:5lsbA	0.124	0.394	8.056E-11	176	0.064	0.210	5lsbA.pdb.gz
13	PDB:6y5qq	0.117	0.350	3.538E-9	178	0.043	0.140	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6y53o	0.117	0.396	1.703E-8	160	0.067	0.244	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:7evoD	0.116	0.310	3.047E-8	200	0.047	0.135	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:7oqcF	0.126	0.259	4.076E-8	267	0.059	0.127	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
17	PDB:6r5kH	0.128	0.176	1.647E-7	394	0.067	0.099	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:6ff7X	0.112	0.347	2.851E-6	171	0.060	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dvqI	0.137	0.569	1.454E-5	128	0.031	0.141	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:3lqvB	0.136	0.638	2.455E-5	115	0.048	0.243	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00425	0.0	1185	579	1.000	1.000	IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens OX=9606 GN=IGF2BP3 PE=1 SV=2
2	O42254	0.0	868	576	0.750	0.753	IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus OX=9031 GN=IGF2BP1 PE=1 SV=1
3	O73932	0.0	927	594	0.824	0.803	IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis OX=8355 GN=igf2bp3-a PE=1 SV=1
4	O88477	0.0	843	577	0.732	0.735	IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus OX=10090 GN=Igf2bp1 PE=1 SV=1
5	Q08CK7	0.0	854	598	0.744	0.721	IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio OX=7955 GN=igf2bp1 PE=1 SV=1
6	Q5SF07	0.0	765	592	0.655	0.640	IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus OX=10090 GN=Igf2bp2 PE=1 SV=1
7	Q8CGX0	0.0	842	577	0.732	0.735	IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igf2bp1 PE=1 SV=1
8	Q9CPN8	0.0	1147	579	0.965	0.965	IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus OX=10090 GN=Igf2bp3 PE=1 SV=1
9	Q9NZI8	0.0	843	577	0.734	0.737	IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2
10	Q9PW80	0.0	905	582	0.777	0.773	IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio OX=7955 GN=igf2bp3 PE=1 SV=1
11	Q9Y6M1	0.0	758	599	0.656	0.634	IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2
12	Q0KHU2	1.18e-111	348	631	0.354	0.325	Q0KHU2_DROME IGF-II mRNA-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
13	M9NF14	1.68e-111	348	638	0.354	0.321	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
14	Q9VZ69	1.54e-100	318	566	0.326	0.334	Q9VZ69_DROME IGF-II mRNA-binding protein OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
15	Q8IR99	1.07e-99	315	573	0.320	0.323	Q8IR99_DROME IGF-II mRNA-binding protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
16	E1JJM0	2.46e-99	315	580	0.321	0.321	E1JJM0_DROME FI20063p1 OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
17	Q8IGK4	1.15e-98	313	580	0.320	0.319	Q8IGK4_DROME RE72930p OS=Drosophila melanogaster OX=7227 GN=Imp PE=2 SV=1
18	Q9LZ82	4.25e-15	78.6	313	0.126	0.233	BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana OX=3702 GN=BTR1 PE=1 SV=1
19	Q0WNX3	2.86e-14	77.8	548	0.162	0.172	Q0WNX3_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g15270 PE=1 SV=1
20	O74919	1.37e-12	72.0	398	0.147	0.214	RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rnc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	1.2e-53	190.1	KH domain
2	PF07650 KH_2	1.3e-12	58.7	KH domain
3	PF13083 KH_4	1.7e-12	58.4	KH domain
4	PF13184 KH_5	0.0038	28.6	NusA-like KH domain
5	PF16005 MOEP19	0.00082	30.6	KH-like RNA-binding domain
6	PF00076 RRM_1	1.2e-14	65.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290341	0.996	Insulin-like growth factor 2 mRNA-binding protein 1
2	9606.ENSP00000325376	0.891	Heterogeneous nuclear ribonucleoprotein M
3	9606.ENSP00000391826	0.747	Insulin-like growth factor II
4	9606.ENSP00000225792	0.738	Probable ATP-dependent RNA helicase DDX5
5	9606.ENSP00000363314	0.736	Protein lin-28 homolog A
6	9606.ENSP00000437621	0.712	High mobility group protein HMGI-C
7	9606.ENSP00000366396	0.686	5'-3' exoribonuclease 2
8	9606.ENSP00000360922	0.654	Double-stranded RNA-binding protein Staufen homolog 1
9	9606.ENSP00000361626	0.631	Nuclease-sensitive element-binding protein 1
10	9606.ENSP00000351108	0.609	Heterogeneous nuclear ribonucleoprotein A/B
11	9606.ENSP00000346694	0.605	Heterogeneous nuclear ribonucleoproteins A2/B1
12	9606.ENSP00000358635	0.595	Heterogeneous nuclear ribonucleoprotein Q
13	9606.ENSP00000378356	0.586	Kinesin-like protein KIF20A
14	9606.ENSP00000377001	0.577	Speckle-type POZ protein
15	9606.ENSP00000438788	0.577	Cullin-7
16	9606.ENSP00000399797	0.576	Putative helicase MOV-10
17	9606.ENSP00000405111	0.566	Putative ATP-dependent RNA helicase DHX57
18	9606.ENSP00000358813	0.553	Dual specificity protein kinase TTK
19	9606.ENSP00000377601	0.542	Lymphoid-specific helicase
20	9606.ENSP00000344401	0.529	Protein lin-28 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0048027	0.947	mRNA 5'-UTR binding
GO:1990247	0.946	N6-methyladenosine-containing RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048519	0.981	negative regulation of biological process
GO:0048518	0.977	positive regulation of biological process
GO:0010468	0.975	regulation of gene expression
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0048523	0.946	negative regulation of cellular process
GO:0010605	0.937	negative regulation of macromolecule metabolic process
GO:0051172	0.923	negative regulation of nitrogen compound metabolic process
GO:0010608	0.911	post-transcriptional regulation of gene expression
GO:0031324	0.896	negative regulation of cellular metabolic process
GO:1903311	0.879	regulation of mRNA metabolic process
GO:0032502	0.877	developmental process
GO:0043488	0.848	regulation of mRNA stability
GO:0032501	0.830	multicellular organismal process
GO:0051246	0.829	regulation of protein metabolic process
GO:0048522	0.821	positive regulation of cellular process
GO:1903312	0.813	negative regulation of mRNA metabolic process
GO:0008152	0.811	metabolic process
GO:0048856	0.800	anatomical structure development
GO:0071704	0.797	organic substance metabolic process
GO:0044238	0.795	primary metabolic process
GO:1902373	0.795	negative regulation of mRNA catabolic process
GO:0006807	0.764	nitrogen compound metabolic process
GO:0048255	0.761	mRNA stabilization
GO:0009889	0.747	regulation of biosynthetic process
GO:0010556	0.744	regulation of macromolecule biosynthetic process
GO:0043170	0.720	macromolecule metabolic process
GO:0044237	0.687	cellular metabolic process
GO:0031326	0.654	regulation of cellular biosynthetic process
GO:0007275	0.536	multicellular organism development
GO:0071840	0.512	cellular component organization or biogenesis
GO:0050896	0.509	response to stimulus
GO:0016043	0.466	cellular component organization
GO:0034641	0.463	cellular nitrogen compound metabolic process
GO:0010629	0.426	negative regulation of gene expression
GO:0090304	0.421	nucleic acid metabolic process
GO:0051173	0.414	positive regulation of nitrogen compound metabolic process
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0048731	0.357	system development
GO:2000112	0.355	regulation of cellular macromolecule biosynthetic process
GO:0010467	0.347	gene expression
GO:0016070	0.336	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005634	0.993	nucleus
GO:0032991	0.982	protein-containing complex
GO:0070013	0.974	intracellular organelle lumen
GO:0005654	0.956	nucleoplasm
GO:0099080	0.894	supramolecular complex
GO:1990904	0.846	ribonucleoprotein complex
GO:0035770	0.777	ribonucleoprotein granule
GO:0036464	0.598	cytoplasmic ribonucleoprotein granule
GO:0005856	0.593	cytoskeleton
GO:0010494	0.493	cytoplasmic stress granule
GO:0000932	0.470	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]