StarFunc result for job id O00443

User Input

>input (1686 residues)
MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSS
TRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVT
PILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFP
STEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNG
KARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLA
KDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNG
TSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEV
LQNNHCLGSHEHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKP
CKEAMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESV
KKLKRAVNLPRSKTADVTSLFGGEDTSRSSTRGSLNPENPVQVSINQLTAAIYDLLRLHA
NSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDL
FKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQSSGSSPDSNK
QRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRY
YCFKHPNCLPKILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAV
TWIEAISDDELTDLLPQFVQALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHD
VQFSTRYEHVLGALLSVGGKRLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRSME
RVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVG
EDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEY
GVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAY
NLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLG
SIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDK
HYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVA
AKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGSFSPTPGQIG
GAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRN
PTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL
TAATYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00443	1.000	1.000	0.000	1686	1.000	1.000	O00443.pdb.gz	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
2	AFDB:Q1L913	0.741	0.725	0.000	1725	0.615	0.601	Q1L913.pdb.gz
3	AFDB:P54674	0.470	0.428	6.013E-55	1857	0.215	0.195	P54674.pdb.gz	PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pikB PE=2 SV=2
4	PDB:6pyuA	0.422	0.747	1.720E-48	930	0.151	0.273	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
5	PDB:7lq1A	0.440	0.762	2.701E-47	950	0.154	0.274	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
6	PDB:4yknA	0.436	0.601	9.476E-47	1205	0.166	0.232	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
7	PDB:7mezA	0.441	0.735	2.945E-46	989	0.163	0.278	7mezA.pdb.gz
8	PDB:6gy0A	0.422	0.841	8.104E-46	822	0.146	0.299	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
9	PDB:4ajwB	0.408	0.843	1.897E-45	792	0.150	0.319	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
10	PDB:5dxtA	0.428	0.799	1.975E-45	879	0.160	0.307	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
11	PDB:5dxhD	0.426	0.714	7.216E-45	981	0.159	0.273	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
12	PDB:5itdA	0.432	0.714	9.201E-45	995	0.162	0.274	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
13	PDB:2y3aA	0.439	0.739	2.445E-43	976	0.161	0.279	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
14	AFDB:Q54I36	0.082	0.098	1.395E-4	1338	0.088	0.111	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
15	AFDB:Q86UR5	0.072	0.072	4.539E-3	1692	0.033	0.033	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
16	AFDB:Q99N50	0.074	0.130	7.684E-3	950	0.031	0.056	Q99N50.pdb.gz	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
17	AFDB:B7Z0K1	0.075	0.110	9.409E-3	1137	0.034	0.050	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
18	AFDB:Q8IZD9	0.066	0.056	1.249E-2	2030	0.067	0.056	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
19	AFDB:E3W994	0.065	0.081	2.202E-2	1273	0.085	0.113	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
20	AFDB:Q6XK20	0.073	0.111	2.924E-2	1102	0.032	0.049	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RUF7	0.0	1354	1634	0.409	0.422	A2RUF7_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=2 SV=1
2	E9QAN8	0.0	1350	1632	0.407	0.421	E9QAN8_MOUSE Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Mus musculus OX=10090 GN=Pik3c2b PE=1 SV=1
3	F5GWN5	0.0	1312	1606	0.402	0.422	F5GWN5_HUMAN Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=1
4	F6NMW9	0.0	2046	1685	0.625	0.626	F6NMW9_DANRE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X2 OS=Danio rerio OX=7955 GN=pik3c2a PE=1 SV=1
5	L7RRS0	0.0	3498	1686	1.000	1.000	L7RRS0_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=3 SV=1
6	O00443	0.0	3498	1686	1.000	1.000	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
7	O00750	0.0	1354	1634	0.409	0.422	P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2
8	O70167	0.0	740	1506	0.282	0.315	P3C2G_MOUSE Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Mus musculus OX=10090 GN=Pik3c2g PE=1 SV=1
9	O70173	0.0	754	1505	0.278	0.312	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
10	O75747	0.0	725	1445	0.281	0.327	P3C2G_HUMAN Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens OX=9606 GN=PIK3C2G PE=1 SV=3
11	Q61194	0.0	3176	1686	0.902	0.902	P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus OX=10090 GN=Pik3c2a PE=1 SV=2
12	Q7JNX6	0.0	851	1876	0.306	0.275	Q7JNX6_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
13	Q7K3H0	0.0	850	1876	0.306	0.275	Q7K3H0_DROME LD28067p OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
14	Q9VTN5	0.0	851	1876	0.306	0.275	Q9VTN5_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=2
15	G5EDY0	6.27e-171	562	1607	0.228	0.239	PIKI1_CAEEL Phosphatidylinositol 3-kinase piki-1 OS=Caenorhabditis elegans OX=6239 GN=piki-1 PE=1 SV=1
16	Q55FX5	4.54e-131	446	1382	0.161	0.196	Q55FX5_DICDI Phosphatidylinositol 3-kinase OS=Dictyostelium discoideum OX=44689 GN=pikF PE=3 SV=1
17	P54673	2.43e-130	447	1571	0.150	0.161	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2
18	P54675	3.01e-124	431	1697	0.157	0.156	PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum OX=44689 GN=pikC PE=2 SV=2
19	P54674	3.17e-116	409	1857	0.150	0.136	PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pikB PE=2 SV=2
20	D3ZFJ0	5.09e-115	394	1102	0.144	0.221	D3ZFJ0_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.6e-12	58.3	C2 domain
2	PF13575 DUF4135	50	14.6	Domain of unknown function (DUF4135)
3	PF00613 PI3Ka	3.5e-37	139.1	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
4	PF00792 PI3K_C2	1.1e-29	114.6	Phosphoinositide 3-kinase C2
5	PF00794 PI3K_rbd	6.6e-25	98.7	PI3-kinase family, ras-binding domain
6	PF00454 PI3_PI4_kinase	1.3e-55	200.5	Phosphatidylinositol 3- and 4-kinase
7	PF00787 PX	2.1e-09	49.3	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376024	0.965	Sorting nexin-9
2	9606.ENSP00000074304	0.954	Type I inositol 3,4-bisphosphate 4-phosphatase
3	9606.ENSP00000264380	0.953	1-phosphatidylinositol 3-phosphate 5-kinase
4	9606.ENSP00000377015	0.950	Phosphatidylinositol-binding clathrin assembly protein
5	9606.ENSP00000360154	0.947	Inositol polyphosphate 5-phosphatase OCRL-1
6	9606.ENSP00000425487	0.946	Type II inositol 3,4-bisphosphate 4-phosphatase
7	9606.ENSP00000298229	0.941	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
8	9606.ENSP00000361021	0.940	Phosphatase and tensin homolog
9	9606.ENSP00000314499	0.938	Cyclin-G-associated kinase
10	9606.ENSP00000359665	0.928	Phosphatidylinositol 4-kinase type 2-alpha
11	9606.ENSP00000447053	0.925	Ras-related protein Rab-5C
12	9606.ENSP00000373713	0.924	Phosphatidylinositide phosphatase SAC1
13	9606.ENSP00000255882	0.923	Phosphatidylinositol 4-kinase alpha
14	9606.ENSP00000354519	0.923	Phosphatidylinositide phosphatase SAC2
15	9606.ENSP00000432083	0.918	Heat shock cognate 71 kDa protein
16	9606.ENSP00000264864	0.917	Phosphatidylinositol 4-kinase type 2-beta
17	9606.ENSP00000368831	0.917	Sorting nexin-2
18	9606.ENSP00000357869	0.916	Phosphatidylinositol 4-kinase beta
19	9606.ENSP00000405338	0.915	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
20	9606.ENSP00000262741	0.914	Phosphatidylinositol 3-kinase regulatory subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016303	0.999	1-phosphatidylinositol-3-kinase activity
GO:0030276	0.994	clathrin binding
GO:0016307	0.983	phosphatidylinositol phosphate kinase activity
GO:0035005	0.843	1-phosphatidylinositol-4-phosphate 3-kinase activity
GO:0046934	0.580	phosphatidylinositol-4,5-bisphosphate 3-kinase activity
GO:0019899	0.370	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006629	0.989	lipid metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0006650	0.970	glycerophospholipid metabolic process
GO:0045017	0.967	glycerolipid biosynthetic process
GO:0046474	0.963	glycerophospholipid biosynthetic process
GO:0046488	0.959	phosphatidylinositol metabolic process
GO:0016043	0.938	cellular component organization
GO:0006661	0.936	phosphatidylinositol biosynthetic process
GO:0050896	0.924	response to stimulus
GO:0007154	0.878	cell communication
GO:0051716	0.878	cellular response to stimulus
GO:0051179	0.775	localization
GO:0032501	0.685	multicellular organismal process
GO:0048518	0.660	positive regulation of biological process
GO:0048522	0.627	positive regulation of cellular process
GO:0023052	0.611	signaling
GO:0019222	0.609	regulation of metabolic process
GO:0051234	0.523	establishment of localization
GO:0048519	0.507	negative regulation of biological process
GO:0006810	0.491	transport
GO:0031323	0.477	regulation of cellular metabolic process
GO:0007165	0.469	signal transduction
GO:0048523	0.416	negative regulation of cellular process
GO:0016192	0.403	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.997	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0016020	0.980	membrane
GO:0012505	0.964	endomembrane system
GO:0031982	0.866	vesicle
GO:0031410	0.842	cytoplasmic vesicle
GO:0005886	0.777	plasma membrane
GO:0065010	0.469	extracellular membrane-bounded organelle
GO:0005794	0.465	Golgi apparatus
GO:0070062	0.459	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	0.999	phosphatidylinositol 3-kinase.
RHEA:18373	0.843	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+)
EC:2.7.1.154	0.843	phosphatidylinositol-4-phosphate 3-kinase.
RHEA:21292	0.580	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+)
EC:2.7.1.153	0.580	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]