StarFunc result for job id O00444

User Input

>input (970 residues)
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQ
NTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILL
MFSNPTPNFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KR82	0.407	0.437	0.000	892	0.919	0.999	J3KR82.pdb.gz	J3KR82_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
2	AFDB:J3KR84	0.379	0.402	0.000	909	0.936	0.999	J3KR84.pdb.gz	J3KR84_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
3	AFDB:O00444	1.000	1.000	0.000	970	1.000	1.000	O00444.pdb.gz	PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=3
4	AFDB:Q64702	0.542	0.564	0.000	925	0.789	0.827	Q64702.pdb.gz	PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus OX=10090 GN=Plk4 PE=1 SV=2
5	AFDB:Q6PAD2	0.420	0.429	0.000	944	0.601	0.618	Q6PAD2.pdb.gz	PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis OX=8355 GN=plk4 PE=2 SV=1
6	AFDB:Q7ZVS3	0.463	0.476	9.616E-97	940	0.515	0.532	Q7ZVS3.pdb.gz	PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio OX=7955 GN=plk4 PE=2 SV=2
7	AFDB:O97143	0.319	0.379	2.392E-64	769	0.322	0.406	O97143.pdb.gz	PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster OX=7227 GN=SAK PE=1 SV=1
8	AFDB:Q76P07	0.274	0.317	3.048E-27	833	0.157	0.182	Q76P07.pdb.gz	Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277165 PE=3 SV=1
9	AFDB:Q54PK9	0.268	0.286	7.077E-27	908	0.144	0.154	Q54PK9.pdb.gz	PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum OX=44689 GN=pdkB PE=3 SV=1
10	AFDB:Q94C95	0.265	0.406	5.812E-26	626	0.118	0.182	Q94C95.pdb.gz	ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1
11	PDB:6b1uA	0.259	0.556	2.476E-24	442	0.085	0.186	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	PDB:4zhxA	0.258	0.599	2.899E-24	409	0.085	0.200	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
13	PDB:5u6yA	0.252	0.521	3.056E-24	459	0.090	0.190	5u6yA.pdb.gz
14	PDB:5ufuA	0.257	0.657	1.139E-23	369	0.085	0.222	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:7myjC	0.256	0.522	1.563E-23	465	0.084	0.174	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:6byrA	0.260	0.611	1.929E-23	405	0.087	0.207	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
17	PDB:5x3fB	0.259	0.703	1.155E-22	349	0.086	0.238	5x3fB.pdb.gz
18	PDB:4rerA	0.261	0.544	2.290E-22	459	0.086	0.181	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:2yaaA	0.255	0.782	2.827E-22	300	0.103	0.333	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
20	PDB:4c0tA	0.256	0.825	3.877E-22	291	0.087	0.289	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KR82	0.0	1025	892	0.504	0.548	J3KR82_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
2	J3KR84	0.0	1873	909	0.936	0.999	J3KR84_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
3	O00444	0.0	2033	970	1.000	1.000	PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=3
4	Q64702	0.0	1526	925	0.787	0.825	PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus OX=10090 GN=Plk4 PE=1 SV=2
5	Q6PAD2	0.0	1116	944	0.612	0.629	PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis OX=8355 GN=plk4 PE=2 SV=1
6	Q7ZVS3	5.23e-169	520	940	0.285	0.294	PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio OX=7955 GN=plk4 PE=2 SV=2
7	O97143	1.10e-114	372	769	0.173	0.218	PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster OX=7227 GN=SAK PE=1 SV=1
8	Q60806	2.01e-65	234	631	0.108	0.166	PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus OX=10090 GN=Plk3 PE=1 SV=2
9	P52304	3.16e-65	232	576	0.112	0.189	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
10	Q9H4B4	3.98e-65	234	646	0.109	0.164	PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens OX=9606 GN=PLK3 PE=1 SV=2
11	Q9R011	1.03e-64	233	647	0.108	0.162	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
12	Q91820	1.94e-64	225	407	0.109	0.260	AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis OX=8355 GN=aurka-a PE=1 SV=1
13	P53351	7.55e-61	222	682	0.107	0.152	PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus OX=10090 GN=Plk2 PE=1 SV=1
14	Q9R012	1.09e-60	222	682	0.107	0.152	PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus OX=10116 GN=Plk2 PE=1 SV=1
15	Q9NYY3	1.36e-60	221	685	0.107	0.152	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
16	Q6DBZ4	1.76e-59	211	405	0.104	0.249	Q6DBZ4_DANRE Aurora kinase OS=Danio rerio OX=7955 GN=zgc:100912 PE=2 SV=1
17	Q4KMI8	2.73e-59	216	595	0.104	0.170	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
18	Q6DRK7	2.92e-59	216	595	0.104	0.170	Q6DRK7_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk1 PE=1 SV=1
19	A6H8T5	1.42e-58	215	657	0.104	0.154	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
20	O14965	4.24e-58	207	403	0.103	0.248	AURKA_HUMAN Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.013	26.2	ABC1 atypical kinase-like domain
2	PF15016 DUF4520	7.4	18.0	Domain of unknown function (DUF4520)
3	PF12330 Haspin_kinase	20	15.6	Haspin like kinase domain
4	PF14531 Kinase-like	6.5	17.6	Kinase-like
5	PF00069 Pkinase	1.8e-67	239.1	Protein kinase domain
6	PF17667 Pkinase_fungal	0.026	25.0	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	1e-41	154.5	Protein tyrosine and serine/threonine kinase
8	PF18190 Plk4_PB1	1.7e-39	145.6	Polo-like Kinase 4 Polo Box 1
9	PF18409 Plk4_PB2	1.4e-34	130.5	Polo-like Kinase 4 Polo Box 2
10	PF00659 POLO_box	0.68	21.4	POLO box duplicated region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370337	0.999	Centrosomal protein of 152 kDa
2	9606.ENSP00000360944	0.998	SCL-interrupting locus protein
3	9606.ENSP00000427550	0.994	Centrosomal protein of 192 kDa
4	9606.ENSP00000359206	0.988	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000287482	0.979	Spindle assembly abnormal protein 6 homolog
6	9606.ENSP00000371308	0.970	Centromere protein J
7	9606.ENSP00000257287	0.957	Centrosomal protein of 135 kDa
8	9606.ENSP00000260731	0.955	Kinesin-like protein KIF11
9	9606.ENSP00000302530	0.942	Mitotic checkpoint serine/threonine-protein kinase BUB1
10	9606.ENSP00000296509	0.936	Mitotic spindle assembly checkpoint protein MAD2A
11	9606.ENSP00000370803	0.930	Centriolar coiled-coil protein of 110 kDa
12	9606.ENSP00000356379	0.928	Abnormal spindle-like microcephaly-associated protein
13	9606.ENSP00000358813	0.921	Dual specificity protein kinase TTK
14	9606.ENSP00000287598	0.917	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
15	9606.ENSP00000265148	0.912	Centromere-associated protein E
16	9606.ENSP00000274026	0.904	Cyclin-A2
17	9606.ENSP00000288207	0.904	G2/mitotic-specific cyclin-B2
18	9606.ENSP00000265094	0.903	F-box/WD repeat-containing protein 11
19	9606.ENSP00000352572	0.903	Pericentrin
20	9606.ENSP00000358458	0.899	Putative nucleotidyltransferase FAM46C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0007010	0.975	cytoskeleton organization
GO:0070925	0.961	organelle assembly
GO:0007049	0.956	cell cycle
GO:0098534	0.946	centriole assembly
GO:0008152	0.939	metabolic process
GO:0071704	0.928	organic substance metabolic process
GO:0044238	0.926	primary metabolic process
GO:0044237	0.918	cellular metabolic process
GO:0043170	0.893	macromolecule metabolic process
GO:0006807	0.889	nitrogen compound metabolic process
GO:0010564	0.824	regulation of cell cycle process
GO:0007098	0.786	centrosome cycle
GO:0051128	0.765	regulation of cellular component organization
GO:1901564	0.724	organonitrogen compound metabolic process
GO:0043412	0.717	macromolecule modification
GO:0019538	0.681	protein metabolic process
GO:0036211	0.667	protein modification process
GO:0007099	0.651	centriole replication
GO:0032886	0.649	regulation of microtubule-based process
GO:0030031	0.589	cell projection assembly
GO:0006468	0.573	protein phosphorylation
GO:0048518	0.564	positive regulation of biological process
GO:0048522	0.486	positive regulation of cellular process
GO:0044782	0.426	cilium organization
GO:0120031	0.422	plasma membrane bounded cell projection assembly
GO:0033043	0.417	regulation of organelle organization
GO:0046605	0.410	regulation of centrosome cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005815	0.996	microtubule organizing center
GO:0005813	0.989	centrosome
GO:0070013	0.919	intracellular organelle lumen
GO:0043231	0.896	intracellular membrane-bounded organelle
GO:0005634	0.887	nucleus
GO:0031981	0.883	nuclear lumen
GO:0032991	0.760	protein-containing complex
GO:0005654	0.336	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]