StarFunc result for job id O00451

User Input

>input (464 residues)
MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTL
RQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGE
EFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSS
YISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGM
IGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTD
VNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSM
CFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00451	1.000	1.000	1.760E-69	464	1.000	1.000	O00451.pdb.gz	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
2	AFDB:B0S6A6	0.662	0.622	7.848E-41	495	0.509	0.477	B0S6A6.pdb.gz	B0S6A6_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfra2 PE=3 SV=1
3	PDB:6gl7C	0.610	0.940	2.499E-39	297	0.640	1.000	6gl7C.pdb.gz
4	AFDB:F1QDI3	0.654	0.631	1.947E-36	481	0.470	0.453	F1QDI3.pdb.gz
5	AFDB:A0A0H2UKX5	0.656	0.644	6.681E-31	473	0.450	0.442	A0A0H2UKX5.pdb.gz
6	AFDB:E7F4G1	0.640	0.648	5.155E-30	458	0.362	0.367	E7F4G1.pdb.gz	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
7	PDB:6q2nC	0.420	0.955	1.096E-18	200	0.269	0.625	6q2nC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
8	AFDB:Q9EPI2	0.425	0.712	1.124E-17	273	0.200	0.341	Q9EPI2.pdb.gz	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
9	AFDB:Q9JJT2	0.422	0.740	1.280E-16	260	0.200	0.358	Q9JJT2.pdb.gz	GFRA4_MOUSE GDNF family receptor alpha-4 OS=Mus musculus OX=10090 GN=Gfra4 PE=2 SV=2
10	PDB:6q2sC	0.397	0.906	7.550E-14	199	0.179	0.417	6q2sC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
11	PDB:7rhqG	0.145	0.352	7.561E-2	160	0.075	0.219	7rhqG.pdb.gz	Structural basis for catalyzed assembly of the Sonic hedgehog-Patched1 signaling complex.
12	AFDB:Q55BD8	0.109	0.070	1.987E-1	899	0.121	0.062	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
13	AFDB:Q8ITC8	0.077	0.067	3.740E-1	579	0.108	0.086	Q8ITC8.pdb.gz	Q8ITC8_DROME Putative corazonin receptor OS=Drosophila melanogaster OX=7227 GN=CrzR PE=2 SV=1
14	AFDB:Q7SYD5	0.096	0.056	4.122E-1	1254	0.144	0.053	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
15	PDB:4g1tB	0.098	0.103	5.042E-1	429	0.093	0.100	4g1tB.pdb.gz
16	PDB:3wojA	0.070	0.052	5.557E-1	698	0.095	0.063	3wojA.pdb.gz	S46 peptidases are the first exopeptidases to be members of clan PA
17	PDB:6qw65B	0.077	0.027	1.153	2001	0.103	0.024	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:3euhB	0.076	0.097	1.400	321	0.067	0.097	3euhB.pdb.gz
19	PDB:5a1vK	0.074	0.041	1.400	1126	0.088	0.036	5a1vK.pdb.gz
20	PDB:1hm6A	0.094	0.111	1.875	343	0.091	0.122	1hm6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A8G6	0.0	595	331	0.614	0.861	A0A8I6A8G6_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
2	A0A8I6B3J9	0.0	861	506	0.901	0.826	A0A8I6B3J9_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
3	O00451	0.0	959	464	1.000	1.000	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
4	O08842	0.0	902	464	0.938	0.938	GFRA2_MOUSE GDNF family receptor alpha-2 OS=Mus musculus OX=10090 GN=Gfra2 PE=1 SV=2
5	O35977	0.0	889	464	0.920	0.920	O35977_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=2 SV=1
6	B0S6A6	4.03e-154	448	495	0.468	0.438	B0S6A6_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfra2 PE=3 SV=1
7	Q98TT9	1.83e-140	413	472	0.494	0.485	Q98TT9_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1a PE=1 SV=2
8	Q98TT8	4.09e-138	407	481	0.476	0.459	Q98TT8_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1b PE=2 SV=2
9	P97785	4.18e-138	407	468	0.476	0.472	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
10	Q62997	1.56e-137	405	468	0.463	0.459	GFRA1_RAT GDNF family receptor alpha-1 OS=Rattus norvegicus OX=10116 GN=Gfra1 PE=1 SV=1
11	P56159	4.82e-137	404	465	0.468	0.467	GFRA1_HUMAN GDNF family receptor alpha-1 OS=Homo sapiens OX=9606 GN=GFRA1 PE=1 SV=2
12	E7F4G1	2.58e-82	263	458	0.315	0.319	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
13	O35118	1.36e-60	205	397	0.261	0.305	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
14	Q6AXR3	6.38e-58	197	397	0.250	0.292	Q6AXR3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=2 SV=1
15	F7F1M3	9.50e-58	197	402	0.250	0.289	F7F1M3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=3 SV=1
16	O60609	2.20e-54	188	400	0.252	0.292	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
17	K9J968	2.77e-47	169	369	0.241	0.304	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
18	Q9EPI2	6.12e-40	146	273	0.188	0.319	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
19	Q9JJT2	9.19e-40	145	260	0.192	0.342	GFRA4_MOUSE GDNF family receptor alpha-4 OS=Mus musculus OX=10090 GN=Gfra4 PE=2 SV=2
20	Q9GZZ7	2.52e-25	107	299	0.183	0.284	GFRA4_HUMAN GDNF family receptor alpha-4 OS=Homo sapiens OX=9606 GN=GFRA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02351 GDNF	2.4e-38	142.2	GDNF/GAS1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302648	0.999	Neurturin
2	9606.ENSP00000347942	0.987	Proto-oncogene tyrosine-protein kinase receptor Ret
3	9606.ENSP00000409007	0.985	Glial cell line-derived neurotrophic factor
4	9606.ENSP00000359719	0.902	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000309591	0.900	cAMP-dependent protein kinase catalytic subunit alpha
6	9606.ENSP00000366488	0.900	cAMP-dependent protein kinase catalytic subunit gamma
7	9606.ENSP00000387435	0.878	Artemin
8	9606.ENSP00000245810	0.796	Persephin
9	9606.ENSP00000276420	0.746	Docking protein 2
10	9606.ENSP00000372160	0.719	Docking protein 6
11	9606.ENSP00000435954	0.690	Potassium voltage-gated channel subfamily V member 1
12	9606.ENSP00000328326	0.649	XK-related protein 4
13	9606.ENSP00000262593	0.642	Docking protein 5
14	9606.ENSP00000434033	0.642	Rap1 GTPase-activating protein 1
15	9606.ENSP00000408695	0.637	Protein kinase C alpha type
16	9606.ENSP00000480132	0.634	Neural cell adhesion molecule 1
17	9606.ENSP00000362680	0.628	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000354952	0.610	GRB2-associated-binding protein 2
19	9606.ENSP00000428056	0.609	Phosphatidylinositol 3-kinase regulatory subunit alpha
20	9606.ENSP00000233668	0.607	Docking protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0016167	0.990	glial cell-derived neurotrophic factor receptor activity
GO:0005515	0.902	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0050896	0.978	response to stimulus
GO:0023052	0.969	signaling
GO:0007154	0.969	cell communication
GO:0051716	0.965	cellular response to stimulus
GO:0007165	0.964	signal transduction
GO:0007169	0.927	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0031952	0.802	regulation of protein autophosphorylation
GO:0048519	0.752	negative regulation of biological process
GO:0032501	0.748	multicellular organismal process
GO:0051172	0.743	negative regulation of nitrogen compound metabolic process
GO:0010563	0.737	negative regulation of phosphorus metabolic process
GO:0048856	0.688	anatomical structure development
GO:0007275	0.608	multicellular organism development
GO:0048731	0.535	system development
GO:0007399	0.349	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0019898	0.912	extrinsic component of membrane
GO:0005622	0.701	intracellular anatomical structure
GO:0032991	0.609	protein-containing complex
GO:0005737	0.570	cytoplasm
GO:0005576	0.548	extracellular region
GO:0005829	0.495	cytosol
GO:0043229	0.315	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]