StarFunc result for job id O00458

User Input

>input (451 residues)
MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDP
SSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFIL
ERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDG
SASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVL
HISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDVNMRIAAGESLALLFELARGI
ESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERDFPTETIKFGP
ERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF
ERHLYNSAAFKARTKARSKCRDKRADVGEFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00458	1.000	1.000	1.729E-58	451	1.000	1.000	O00458.pdb.gz	IFRD1_HUMAN Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4
2	AFDB:Q12894	0.870	0.777	3.080E-36	506	0.497	0.443	Q12894.pdb.gz	IFRD2_HUMAN Interferon-related developmental regulator 2 OS=Homo sapiens OX=9606 GN=IFRD2 PE=1 SV=4
3	AFDB:Q9VQI5	0.809	0.856	3.619E-25	425	0.335	0.355	Q9VQI5.pdb.gz	Q9VQI5_DROME Interferon-related developmental regulator 1 OS=Drosophila melanogaster OX=7227 GN=Ifrd1 PE=1 SV=2
4	AFDB:F4HUS5	0.626	0.639	2.048E-18	441	0.239	0.245	F4HUS5.pdb.gz	F4HUS5_ARATH Interferon-related developmental regulator family protein / IFRD protein family OS=Arabidopsis thaliana OX=3702 GN=SAT32 PE=1 SV=1
5	AFDB:F4ILG6	0.304	0.191	1.409E-4	829	0.115	0.063	F4ILG6.pdb.gz	F4ILG6_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=PUB4 PE=1 SV=1
6	AFDB:Q17423	0.305	0.136	3.743E-4	1282	0.075	0.027	Q17423.pdb.gz	CREC_CAEEL Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3
7	AFDB:B2RY50	0.388	0.191	6.231E-4	1037	0.093	0.041	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
8	PDB:1b3uA	0.350	0.281	8.035E-4	588	0.102	0.078	1b3uA.pdb.gz
9	PDB:5voxP	0.344	0.339	9.127E-4	462	0.093	0.091	5voxP.pdb.gz
10	PDB:6x9oA	0.409	0.094	9.936E-4	2425	0.118	0.022	6x9oA.pdb.gz
11	PDB:7bfpC	0.372	0.530	9.936E-4	298	0.102	0.154	7bfpC.pdb.gz
12	AFDB:Q08972	0.186	0.096	1.083E-3	1196	0.129	0.048	Q08972.pdb.gz	NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEW1 PE=1 SV=1
13	AFDB:Q8IAW0	0.387	0.332	1.457E-3	545	0.089	0.073	Q8IAW0.pdb.gz	Q8IAW0_PLAF7 Importin subunit alpha OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0812400 PE=3 SV=1
14	AFDB:Q5BAH2	0.435	0.205	1.881E-3	1041	0.104	0.045	Q5BAH2.pdb.gz	CAN1C_EMENI Cullin-associated NEDD8-dissociated protein 1, C-terminal part OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=candA-C PE=1 SV=1
15	PDB:7cunG	0.283	0.160	5.209E-3	895	0.118	0.059	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:7anwA	0.291	0.214	7.635E-3	645	0.100	0.070	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
17	PDB:7mqaSP	0.367	0.085	8.673E-3	2485	0.089	0.016	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7sn8D	0.398	0.444	8.673E-3	399	0.078	0.088	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
19	PDB:3gniA	0.332	0.419	9.852E-3	335	0.098	0.131	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
20	PDB:2z6gA	0.353	0.298	1.119E-2	550	0.098	0.080	2z6gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00458	0.0	936	451	1.000	1.000	IFRD1_HUMAN Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4
2	P19182	0.0	850	449	0.922	0.927	IFRD1_MOUSE Interferon-related developmental regulator 1 OS=Mus musculus OX=10090 GN=Ifrd1 PE=1 SV=2
3	P20695	0.0	842	449	0.916	0.920	IFRD1_RAT Interferon-related developmental regulator 1 OS=Rattus norvegicus OX=10116 GN=Ifrd1 PE=2 SV=1
4	Q12894	2.42e-130	388	506	0.481	0.429	IFRD2_HUMAN Interferon-related developmental regulator 2 OS=Homo sapiens OX=9606 GN=IFRD2 PE=1 SV=4
5	Q9VQI5	9.39e-82	260	425	0.344	0.365	Q9VQI5_DROME Interferon-related developmental regulator 1 OS=Drosophila melanogaster OX=7227 GN=Ifrd1 PE=1 SV=2
6	F4HUS5	5.11e-30	123	441	0.231	0.236	F4HUS5_ARATH Interferon-related developmental regulator family protein / IFRD protein family OS=Arabidopsis thaliana OX=3702 GN=SAT32 PE=1 SV=1
7	O42973	6.28e-04	44.3	446	0.058	0.058	YGZ3_SCHPO Uncharacterized protein C20F10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC20F10.03 PE=1 SV=1
8	Q385J4	3.7	32.7	1004	0.051	0.023	Q385J4_TRYB2 Formin B OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3470 PE=3 SV=1
9	Q8BIY3	5.6	32.0	533	0.064	0.054	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
10	F4HRS2	6.2	32.0	2222	0.086	0.018	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
11	Q99MB7	6.2	31.2	230	0.038	0.074	RN141_MOUSE RING finger protein 141 OS=Mus musculus OX=10090 GN=Rnf141 PE=1 SV=2
12	Q386Y0	7.8	31.6	800	0.058	0.033	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12130 bMERB_dom	6.9e+02	11.8	Bivalent Mical/EHBP Rab binding domain
2	PF02985 HEAT	24	16.5	HEAT repeat
3	PF05004 IFRD	3e-84	294.3	Interferon-related developmental regulator (IFRD)
4	PF04836 IFRD_C	8.7e-21	85.6	Interferon-related protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384477

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369131	0.853	Paired amphipathic helix protein Sin3b
2	9606.ENSP00000362649	0.808	Histone deacetylase 1
3	9606.ENSP00000435370	0.760	Ubiquitin-like protein FUBI
4	9606.ENSP00000361820	0.689	Protein BHLHb9
5	9606.ENSP00000250003	0.685	Myoblast determination protein 1
6	9606.ENSP00000394352	0.678	Dixin
7	9606.ENSP00000340874	0.627	Myocyte-specific enhancer factor 2C
8	9606.ENSP00000386717	0.600	Ribosomal protein L31
9	9606.ENSP00000344456	0.582	Catenin beta-1
10	9606.ENSP00000429374	0.573	Ribosomal protein S20
11	9606.ENSP00000464342	0.565	60S ribosomal protein L36
12	9606.ENSP00000303570	0.563	Ankyrin repeat and MYND domain-containing protein 2
13	9606.ENSP00000388638	0.545	Splicing factor 45
14	9606.ENSP00000346015	0.539	Ribosomal protein L27a
15	9606.ENSP00000262584	0.537	60S ribosomal protein L8
16	9606.ENSP00000296674	0.537	40S ribosomal protein S23
17	9606.ENSP00000472985	0.537	Ribosomal protein S5
18	9606.ENSP00000202816	0.534	ESF1 homolog
19	9606.ENSP00000363018	0.532	60S ribosomal protein L10a
20	9606.ENSP00000230050	0.530	Ribosomal protein S12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0140297	0.965	DNA-binding transcription factor binding
GO:0061629	0.962	RNA polymerase II-specific DNA-binding transcription factor binding
GO:1901363	0.314	heterocyclic compound binding
GO:0097159	0.312	organic cyclic compound binding
GO:0003676	0.301	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.987	biological regulation
GO:0050789	0.976	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0032502	0.910	developmental process
GO:0061061	0.891	muscle structure development
GO:0048869	0.825	cellular developmental process
GO:0030154	0.822	cell differentiation
GO:0042692	0.666	muscle cell differentiation
GO:0048519	0.632	negative regulation of biological process
GO:0019222	0.558	regulation of metabolic process
GO:0048518	0.550	positive regulation of biological process
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0080090	0.536	regulation of primary metabolic process
GO:0051171	0.536	regulation of nitrogen compound metabolic process
GO:0010468	0.530	regulation of gene expression
GO:0031323	0.524	regulation of cellular metabolic process
GO:0048522	0.477	positive regulation of cellular process
GO:0071840	0.476	cellular component organization or biogenesis
GO:0045445	0.470	myoblast differentiation
GO:0045165	0.462	cell fate commitment
GO:0048523	0.460	negative regulation of cellular process
GO:0009893	0.318	positive regulation of metabolic process
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0008152	0.310	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0032991	0.969	protein-containing complex
GO:0070013	0.965	intracellular organelle lumen
GO:0031981	0.964	nuclear lumen
GO:0005654	0.949	nucleoplasm
GO:0005829	0.927	cytosol
GO:0043232	0.569	intracellular non-membrane-bounded organelle
GO:0016020	0.467	membrane
GO:0012505	0.382	endomembrane system
GO:0016528	0.335	sarcoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]