StarFunc result for job id O00459

User Input

>input (728 residues)
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALG
PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPAAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00459	1.000	1.000	0.000	728	1.000	1.000	O00459.pdb.gz	P85B_HUMAN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2
2	AFDB:O08908	0.873	0.879	1.140E-102	722	0.887	0.895	O08908.pdb.gz	P85B_MOUSE Phosphatidylinositol 3-kinase regulatory subunit beta OS=Mus musculus OX=10090 GN=Pik3r2 PE=1 SV=2
3	AFDB:P23727	0.600	0.603	2.666E-76	724	0.596	0.599	P23727.pdb.gz	P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus OX=9913 GN=PIK3R1 PE=1 SV=1
4	AFDB:Q63789	0.524	0.805	1.631E-49	461	0.420	0.664	Q63789.pdb.gz	P55G_RAT Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3r3 PE=2 SV=1
5	AFDB:O18683	0.323	0.445	3.720E-28	506	0.195	0.281	O18683.pdb.gz	O18683_DROME LD42724p OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=2 SV=3
6	PDB:7myoB	0.364	0.900	4.590E-24	286	0.297	0.755	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
7	PDB:8dcxB	0.311	0.927	4.440E-21	236	0.257	0.792	8dcxB.pdb.gz
8	AFDB:G5EDP9	0.189	0.258	7.229E-20	522	0.147	0.205	G5EDP9.pdb.gz	G5EDP9_CAEEL Phosphoinositide 3-kinase adapter subunit OS=Caenorhabditis elegans OX=6239 GN=aap-1 PE=1 SV=1
9	PDB:4yknA	0.277	0.168	7.049E-15	1205	0.227	0.137	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
10	PDB:4fl2A	0.132	0.172	5.709E-9	555	0.095	0.124	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
11	AFDB:P16885	0.134	0.078	2.198E-8	1265	0.092	0.053	P16885.pdb.gz	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
12	AFDB:Q95PX0	0.138	0.245	3.913E-8	397	0.100	0.184	Q95PX0.pdb.gz	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
13	AFDB:A7KAX9	0.200	0.075	4.105E-8	2087	0.096	0.034	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
14	AFDB:M9MM92	0.129	0.154	5.221E-8	604	0.091	0.109	M9MM92.pdb.gz
15	PDB:4k2rA	0.127	0.166	1.733E-7	551	0.081	0.107	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4gwfA	0.130	0.188	4.991E-7	497	0.073	0.107	4gwfA.pdb.gz
17	PDB:5xzrA	0.122	0.170	7.023E-6	519	0.077	0.108	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
18	PDB:1k9aB	0.119	0.193	1.250E-5	441	0.063	0.104	1k9aB.pdb.gz
19	PDB:3ps5A	0.124	0.168	1.515E-5	529	0.071	0.098	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
20	PDB:5c2kA	0.191	0.345	5.289E-5	382	0.074	0.141	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C8M4	0.0	677	424	0.438	0.752	E1C8M4_CHICK Phosphoinositide-3-kinase regulatory subunit 1 OS=Gallus gallus OX=9031 GN=PIK3R1 PE=1 SV=2
2	O00459	0.0	1483	728	1.000	1.000	P85B_HUMAN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2
3	O08908	0.0	1265	722	0.889	0.896	P85B_MOUSE Phosphatidylinositol 3-kinase regulatory subunit beta OS=Mus musculus OX=10090 GN=Pik3r2 PE=1 SV=2
4	P23726	0.0	1420	724	0.963	0.968	P85B_BOVIN Phosphatidylinositol 3-kinase regulatory subunit beta OS=Bos taurus OX=9913 GN=PIK3R2 PE=1 SV=1
5	P23727	0.0	840	724	0.587	0.590	P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus OX=9913 GN=PIK3R1 PE=1 SV=1
6	P26450	0.0	820	724	0.581	0.584	P85A_MOUSE Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Mus musculus OX=10090 GN=Pik3r1 PE=1 SV=2
7	P27986	0.0	836	724	0.585	0.588	P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Homo sapiens OX=9606 GN=PIK3R1 PE=1 SV=2
8	Q63787	0.0	812	724	0.578	0.581	P85A_RAT Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Rattus norvegicus OX=10116 GN=Pik3r1 PE=1 SV=1
9	Q63788	0.0	1256	722	0.865	0.873	P85B_RAT Phosphatidylinositol 3-kinase regulatory subunit beta OS=Rattus norvegicus OX=10116 GN=Pik3r2 PE=2 SV=1
10	Q63789	0.0	638	461	0.404	0.638	P55G_RAT Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3r3 PE=2 SV=1
11	Q64143	0.0	640	461	0.405	0.640	P55G_MOUSE Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Mus musculus OX=10090 GN=Pik3r3 PE=1 SV=1
12	Q8N381	0.0	645	461	0.409	0.646	Q8N381_HUMAN Phosphoinositide-3-kinase, regulatory subunit 3 (Gamma) OS=Homo sapiens OX=9606 GN=PIK3R3 PE=1 SV=1
13	Q92569	0.0	647	461	0.411	0.649	P55G_HUMAN Phosphatidylinositol 3-kinase regulatory subunit gamma OS=Homo sapiens OX=9606 GN=PIK3R3 PE=1 SV=2
14	O18683	7.12e-62	218	506	0.203	0.292	O18683_DROME LD42724p OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=2 SV=3
15	Q7KTZ2	8.09e-62	217	496	0.203	0.298	Q7KTZ2_DROME Pi3K21B, isoform B OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=1 SV=1
16	M9PAY7	3.60e-27	111	197	0.076	0.279	M9PAY7_DROME Pi3K21B, isoform C OS=Drosophila melanogaster OX=7227 GN=Pi3K21B PE=1 SV=1
17	G5EDP9	7.59e-27	117	522	0.173	0.241	G5EDP9_CAEEL Phosphoinositide 3-kinase adapter subunit OS=Caenorhabditis elegans OX=6239 GN=aap-1 PE=1 SV=1
18	P42679	1.68e-10	66.6	507	0.049	0.071	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
19	Q9UKW4	4.61e-09	62.4	847	0.044	0.038	VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens OX=9606 GN=VAV3 PE=1 SV=1
20	Q45FX5	5.54e-09	62.0	1007	0.045	0.033	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16454 PI3K_P85_iSH2	1.3e-56	202.1	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
2	PF00620 RhoGAP	5.3e-08	44.3	RhoGAP domain
3	PF01776 Ribosomal_L22e	86	14.9	Ribosomal L22e protein family
4	PF00017 SH2	1.8e-37	138.6	SH2 domain
5	PF00018 SH3_1	1.2	20.1	SH3 domain
6	PF14604 SH3_9	4.9	18.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263967	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
2	9606.ENSP00000289153	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
3	9606.ENSP00000304895	0.999	Insulin receptor substrate 1
4	9606.ENSP00000366563	0.995	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
5	9606.ENSP00000275493	0.992	Epidermal growth factor receptor
6	9606.ENSP00000267101	0.990	Receptor tyrosine-protein kinase erbB-3
7	9606.ENSP00000361021	0.988	Phosphatase and tensin homolog
8	9606.ENSP00000264033	0.978	E3 ubiquitin-protein ligase CBL
9	9606.ENSP00000428056	0.975	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000262741	0.974	Phosphatidylinositol 3-kinase regulatory subunit gamma
11	9606.ENSP00000269571	0.973	Receptor tyrosine-protein kinase erbB-2
12	9606.ENSP00000288135	0.969	Mast/stem cell growth factor receptor Kit
13	9606.ENSP00000352121	0.967	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
14	9606.ENSP00000362680	0.955	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000365016	0.955	Insulin receptor substrate 2
16	9606.ENSP00000300574	0.947	Adapter molecule crk
17	9606.ENSP00000417601	0.946	F-box/LRR-repeat protein 2
18	9606.ENSP00000392812	0.939	Phosphoinositide 3-kinase regulatory subunit 5
19	9606.ENSP00000354558	0.935	Serine/threonine-protein kinase mTOR
20	9606.ENSP00000425487	0.934	Type II inositol 3,4-bisphosphate 4-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.965	enzyme binding
GO:0005102	0.958	signaling receptor binding
GO:0030971	0.841	receptor tyrosine kinase binding
GO:0098772	0.767	molecular function regulator activity
GO:0051219	0.749	phosphoprotein binding
GO:0001784	0.725	phosphotyrosine residue binding
GO:0030234	0.501	enzyme regulator activity
GO:0003824	0.434	catalytic activity
GO:0019903	0.318	protein phosphatase binding
GO:0043548	0.302	phosphatidylinositol 3-kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0050896	0.992	response to stimulus
GO:0007165	0.977	signal transduction
GO:0019222	0.969	regulation of metabolic process
GO:0048518	0.968	positive regulation of biological process
GO:0031323	0.944	regulation of cellular metabolic process
GO:0048522	0.932	positive regulation of cellular process
GO:0048583	0.930	regulation of response to stimulus
GO:0048519	0.915	negative regulation of biological process
GO:0048523	0.892	negative regulation of cellular process
GO:0009966	0.881	regulation of signal transduction
GO:0007166	0.865	cell surface receptor signaling pathway
GO:0035556	0.855	intracellular signal transduction
GO:1902531	0.757	regulation of intracellular signal transduction
GO:0007169	0.694	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042221	0.667	response to chemical
GO:0048017	0.666	inositol lipid-mediated signaling
GO:0070887	0.611	cellular response to chemical stimulus
GO:0060255	0.604	regulation of macromolecule metabolic process
GO:0071495	0.578	cellular response to endogenous stimulus
GO:0008152	0.568	metabolic process
GO:0071310	0.553	cellular response to organic substance
GO:0080090	0.533	regulation of primary metabolic process
GO:0044237	0.514	cellular metabolic process
GO:0071704	0.496	organic substance metabolic process
GO:0051171	0.483	regulation of nitrogen compound metabolic process
GO:0009893	0.471	positive regulation of metabolic process
GO:0031325	0.455	positive regulation of cellular metabolic process
GO:0051239	0.454	regulation of multicellular organismal process
GO:0010604	0.434	positive regulation of macromolecule metabolic process
GO:0044238	0.404	primary metabolic process
GO:1901701	0.378	cellular response to oxygen-containing compound
GO:1901652	0.368	response to peptide
GO:0071417	0.367	cellular response to organonitrogen compound
GO:1901653	0.362	cellular response to peptide
GO:0032870	0.353	cellular response to hormone stimulus
GO:0010468	0.317	regulation of gene expression
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.989	membrane
GO:0043226	0.980	organelle
GO:0043229	0.971	intracellular organelle
GO:0043227	0.964	membrane-bounded organelle
GO:0032991	0.957	protein-containing complex
GO:0071944	0.955	cell periphery
GO:0005886	0.949	plasma membrane
GO:0005634	0.915	nucleus
GO:0019898	0.761	extrinsic component of membrane
GO:1902494	0.748	catalytic complex
GO:0098796	0.723	membrane protein complex
GO:1990234	0.679	transferase complex
GO:0061695	0.487	transferase complex, transferring phosphorus-containing groups
GO:0043233	0.453	organelle lumen
GO:0070013	0.422	intracellular organelle lumen
GO:0005942	0.412	phosphatidylinositol 3-kinase complex
GO:0031981	0.392	nuclear lumen
GO:0030054	0.315	cell junction
GO:0043232	0.309	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]