StarFunc result for job id O00463

User Input

>input (557 residues)
MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQ
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00463	1.000	1.000	0.000	557	1.000	1.000	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
2	AFDB:P70191	0.453	0.453	4.964E-90	558	0.797	0.796	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
3	AFDB:Q13114	0.337	0.330	1.731E-62	568	0.413	0.405	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
4	AFDB:Q6DEG0	0.316	0.307	8.790E-61	573	0.395	0.384	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
5	AFDB:P39429	0.373	0.414	7.171E-50	501	0.316	0.351	P39429.pdb.gz	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
6	AFDB:A0A024R8H5	0.357	0.395	1.622E-48	501	0.302	0.335	A0A024R8H5.pdb.gz
7	AFDB:Q6DJN2	0.334	0.335	7.749E-40	556	0.253	0.254	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
8	AFDB:Q7T1K2	0.275	0.324	1.740E-39	470	0.259	0.306	Q7T1K2.pdb.gz	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
9	AFDB:Q3MV19	0.354	0.355	2.606E-39	556	0.246	0.246	Q3MV19.pdb.gz	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
10	AFDB:Q9Y4K3	0.366	0.389	2.606E-39	522	0.255	0.272	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
11	PDB:5dkaA	0.136	0.665	9.866E-5	96	0.047	0.271	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:7bhqB	0.067	0.138	1.338E-2	204	0.057	0.157	7bhqB.pdb.gz
13	PDB:3t6qC	0.108	0.309	1.417E-2	139	0.034	0.137	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:4r8pL	0.109	0.235	1.785E-2	254	0.047	0.102	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:5gm6a	0.077	0.317	3.783E-2	123	0.027	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:2lgvA	0.078	0.378	6.362E-2	100	0.036	0.200	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
17	PDB:5a31B	0.088	0.483	8.492E-2	84	0.029	0.190	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
18	PDB:7jzvA	0.105	0.226	8.492E-2	253	0.027	0.059	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
19	PDB:4gwqB	0.097	0.109	1.070E-1	492	0.052	0.059	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
20	PDB:3b2dC	0.109	0.311	1.133E-1	139	0.031	0.122	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00463	0.0	1157	557	1.000	1.000	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
2	P70191	0.0	949	558	0.799	0.797	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
3	Q13114	8.80e-152	449	568	0.417	0.408	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
4	Q60803	3.13e-151	447	567	0.417	0.409	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
5	Q6DEG0	1.74e-146	435	573	0.391	0.380	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
6	P39429	4.62e-93	295	501	0.332	0.369	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
7	B5DFH7	8.73e-92	292	497	0.321	0.360	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
8	Q12933	2.25e-90	288	501	0.314	0.349	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
9	P39428	2.62e-65	220	409	0.259	0.352	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
10	Q4VA12	3.93e-64	217	409	0.257	0.350	Q4VA12_MOUSE TNF receptor-associated factor OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=1
11	Q13077	4.37e-62	212	416	0.255	0.341	TRAF1_HUMAN TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1
12	Q6DJN2	2.37e-50	184	556	0.271	0.272	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
13	Q3MV19	3.69e-50	183	556	0.266	0.266	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
14	Q6IWL4	8.22e-50	182	542	0.276	0.284	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
15	E1C626	4.55e-48	177	545	0.268	0.273	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
16	Q9Y4K3	3.77e-46	171	522	0.257	0.274	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
17	Q9UAC5	4.07e-36	141	412	0.124	0.167	Q9UAC5_DROME TRAF1 OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=2 SV=1
18	Q7T1K2	5.58e-36	142	470	0.127	0.151	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
19	A8DYU9	8.53e-36	142	477	0.124	0.145	A8DYU9_DROME TNF-receptor-associated factor 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=4 SV=2
20	Q9XYR0	1.42e-35	141	486	0.124	0.142	Q9XYR0_DROME LD20987p OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13720 Acetyltransf_11	88	14.9	Udp N-acetylglucosamine O-acyltransferase; Domain 2
2	PF08614 ATG16	17	17.1	Autophagy protein 16 (ATG16)
3	PF10167 BORCS8	59	15.0	BLOC-1-related complex sub-unit 8
4	PF16299 DUF4941	31	15.2	Domain of unknown function (DUF4941)
5	PF05377 FlaC_arch	2.3e+02	13.6	Flagella accessory protein C (FlaC)
6	PF15704 Mt_ATP_synt	2.7e+02	12.8	Mitochondrial ATP synthase subunit
7	PF03285 Paralemmin	27	15.7	Paralemmin
8	PF14703 PHM7_cyt	5.4e+02	12.2	Cytosolic domain of 10TM putative phosphate transporter
9	PF03145 Sina	28	16.2	Seven in absentia protein family
10	PF17082 Spc29	8.6	17.7	Spindle Pole Component 29
11	PF17848 zf-ACC	7.3	18.2	Acetyl-coA carboxylase zinc finger domain
12	PF00097 zf-C3HC4	0.07	24.3	Zinc finger, C3HC4 type (RING finger)
13	PF13923 zf-C3HC4_2	0.15	23.2	Zinc finger, C3HC4 type (RING finger)
14	PF15227 zf-C3HC4_4	16	17.0	zinc finger of C3HC4-type, RING
15	PF13639 zf-RING_2	32	16.3	Ring finger domain
16	PF14835 zf-RING_6	11	17.3	zf-RING of BARD1-type protein
17	PF13445 zf-RING_UBOX	8.9	17.8	RING-type zinc-finger
18	PF02176 zf-TRAF	1.1e-28	111.0	TRAF-type zinc finger
19	PF15965 zf-TRAF_2	0.65	21.9	TRAF-like zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361359	0.998	Tumor necrosis factor receptor superfamily member 5
2	9606.ENSP00000341268	0.997	Tumor necrosis factor receptor type 1-associated DEATH domain protein
3	9606.ENSP00000477613	0.994	Baculoviral IAP repeat-containing protein 2
4	9606.ENSP00000228918	0.990	Tumor necrosis factor receptor superfamily member 3
5	9606.ENSP00000454207	0.988	TNF receptor-associated factor 3
6	9606.ENSP00000259808	0.982	Receptor-interacting serine/threonine-protein kinase 1
7	9606.ENSP00000401980	0.981	Mitochondrial antiviral-signaling protein
8	9606.ENSP00000162749	0.975	Tumor necrosis factor receptor superfamily member 1A
9	9606.ENSP00000261652	0.975	Tumor necrosis factor receptor superfamily member 13B
10	9606.ENSP00000263464	0.975	Baculoviral IAP repeat-containing protein 3
11	9606.ENSP00000433623	0.975	TNF receptor-associated factor 6
12	9606.ENSP00000247668	0.972	TNF receptor-associated factor 2
13	9606.ENSP00000053243	0.945	Tumor necrosis factor receptor superfamily member 17
14	9606.ENSP00000365048	0.939	Tumor necrosis factor ligand superfamily member 13B
15	9606.ENSP00000347948	0.930	Tumor necrosis factor receptor superfamily member 14
16	9606.ENSP00000316176	0.927	Ubiquitin-conjugating enzyme E2 N
17	9606.ENSP00000263932	0.926	Tumor necrosis factor receptor superfamily member 8
18	9606.ENSP00000358335	0.922	Mitogen-activated protein kinase kinase kinase 7
19	9606.ENSP00000220751	0.911	Receptor-interacting serine/threonine-protein kinase 2
20	9606.ENSP00000343505	0.906	Tumor necrosis factor ligand superfamily member 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	0.998	ubiquitin-like protein ligase binding
GO:0031625	0.991	ubiquitin protein ligase binding
GO:0042802	0.986	identical protein binding
GO:0031996	0.674	thioesterase binding
GO:0003824	0.352	catalytic activity
GO:0140096	0.328	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0051716	0.996	cellular response to stimulus
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0048522	0.986	positive regulation of cellular process
GO:0007165	0.982	signal transduction
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0009966	0.967	regulation of signal transduction
GO:0051090	0.964	regulation of DNA-binding transcription factor activity
GO:0051091	0.952	positive regulation of DNA-binding transcription factor activity
GO:0043122	0.942	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051092	0.940	positive regulation of NF-kappaB transcription factor activity
GO:0048584	0.923	positive regulation of response to stimulus
GO:0010647	0.828	positive regulation of cell communication
GO:0043123	0.789	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0009893	0.711	positive regulation of metabolic process
GO:0010604	0.658	positive regulation of macromolecule metabolic process
GO:0042221	0.476	response to chemical
GO:0007166	0.474	cell surface receptor signaling pathway
GO:0048523	0.458	negative regulation of cellular process
GO:0010033	0.440	response to organic substance
GO:0051173	0.433	positive regulation of nitrogen compound metabolic process
GO:0071345	0.416	cellular response to cytokine stimulus
GO:0051246	0.362	regulation of protein metabolic process
GO:0071704	0.360	organic substance metabolic process
GO:0031325	0.360	positive regulation of cellular metabolic process
GO:0080134	0.337	regulation of response to stress
GO:0002682	0.329	regulation of immune system process
GO:0044238	0.310	primary metabolic process
GO:0006807	0.308	nitrogen compound metabolic process
GO:0043170	0.302	macromolecule metabolic process
GO:0002684	0.302	positive regulation of immune system process
GO:0019221	0.300	cytokine-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.998	cytosol
GO:0016020	0.973	membrane
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0071944	0.946	cell periphery
GO:0032991	0.938	protein-containing complex
GO:0005886	0.914	plasma membrane
GO:0005856	0.822	cytoskeleton
GO:0043231	0.792	intracellular membrane-bounded organelle
GO:0015630	0.781	microtubule cytoskeleton
GO:0005815	0.703	microtubule organizing center
GO:0005813	0.510	centrosome
GO:0005634	0.350	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]