StarFunc result for job id O00468

User Input

>input (2068 residues)
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPV
QHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPA
PPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRG
PCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLR
RACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVT
CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCA
VKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCE
TCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEAR
AGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITA
ARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPAT
CAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQ
ISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPP
SSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGG
GSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLEL
EGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSV
RAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGA
TSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPG
RRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGR
SFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGP
AVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPE
DQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHG
GAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRE
GTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYN
GQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRV
GDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGR
QLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGL
VEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSL
RTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVA
HREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCL
RDVVVGRHPLHLLEDAVTKPELRPCPTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R074	0.177	0.180	0.000	2026	0.554	0.565	F1R074.pdb.gz
2	AFDB:O00468	1.000	1.000	0.000	2068	1.000	1.000	O00468.pdb.gz	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
3	AFDB:P25304	0.193	0.203	0.000	1959	0.762	0.804	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
4	AFDB:P31696	0.180	0.179	0.000	2081	0.640	0.636	P31696.pdb.gz	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
5	AFDB:Q5EBX5	0.148	0.290	0.000	961	0.388	0.835	Q5EBX5.pdb.gz	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
6	AFDB:P97927	0.082	0.093	7.797E-32	1816	0.061	0.069	P97927.pdb.gz	LAMA4_MOUSE Laminin subunit alpha-4 OS=Mus musculus OX=10090 GN=Lama4 PE=1 SV=2
7	AFDB:F1QYU0	0.079	0.087	2.318E-30	1871	0.056	0.062	F1QYU0.pdb.gz
8	PDB:2p6aD	0.044	0.207	1.156E-8	292	0.034	0.243	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
9	PDB:6m5yA	0.052	0.311	1.091E-7	270	0.019	0.148	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
10	AFDB:Q20684	0.056	0.086	3.186E-7	1245	0.051	0.084	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
11	PDB:7u9tA	0.058	0.041	1.029E-6	4229	0.046	0.022	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
12	PDB:7ufgB	0.065	0.106	1.534E-6	1182	0.022	0.039	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	AFDB:Q63661	0.052	0.048	1.737E-6	2344	0.071	0.062	Q63661.pdb.gz	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
14	PDB:3b4vD	0.036	0.228	3.583E-6	213	0.028	0.268	3b4vD.pdb.gz
15	PDB:7tzcA	0.057	0.041	3.583E-6	4404	0.045	0.021	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
16	PDB:7ufgA	0.064	0.108	3.959E-6	1151	0.017	0.030	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7ua3A	0.061	0.040	6.202E-6	4443	0.048	0.022	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
18	PDB:8a7eC	0.062	0.081	1.448E-5	1524	0.017	0.024	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
19	PDB:7m6aA	0.058	0.040	2.269E-5	4306	0.042	0.020	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	AFDB:Q9VTR6	0.045	0.050	2.984E-5	1713	0.082	0.099	Q9VTR6.pdb.gz	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IJ40	0.0	1957	1926	0.499	0.536	A0A0R4IJ40_DANRE Agrin OS=Danio rerio OX=7955 GN=hm:gc12 PE=1 SV=1
2	A2ASQ1	0.0	3043	1950	0.750	0.795	AGRIN_MOUSE Agrin OS=Mus musculus OX=10090 GN=Agrn PE=1 SV=1
3	B3GQ72	0.0	2154	2028	0.548	0.559	B3GQ72_DANRE Agrin OS=Danio rerio OX=7955 GN=wu:fb57e07 PE=1 SV=1
4	O00468	0.0	4138	2068	1.000	1.000	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
5	P25304	0.0	3076	1959	0.761	0.803	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
6	P31696	0.0	2602	2081	0.636	0.632	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
7	Q5EBX5	0.0	1192	961	0.287	0.617	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
8	G5EG68	2.29e-95	343	1473	0.124	0.174	G5EG68_CAEEL AGRin (Synaptic protein) homolog family member OS=Caenorhabditis elegans OX=6239 GN=agr-1 PE=1 SV=1
9	Q63HQ2	2.68e-86	308	1017	0.115	0.233	EGFLA_HUMAN Pikachurin OS=Homo sapiens OX=9606 GN=EGFLAM PE=1 SV=2
10	Q05793	9.90e-86	317	3707	0.122	0.068	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
11	A0A8I6A2S5	5.40e-85	314	4402	0.122	0.057	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
12	A0A8I6ASH2	5.73e-85	314	4387	0.122	0.057	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
13	P98160	1.83e-83	309	4391	0.121	0.057	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
14	Q4VBE4	1.57e-81	294	1017	0.111	0.225	EGFLA_MOUSE Pikachurin OS=Mus musculus OX=10090 GN=Egflam PE=1 SV=1
15	M9NE56	7.26e-65	248	4176	0.101	0.050	M9NE56_DROME Terribly reduced optic lobes, isoform AK OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=1
16	Q8MPN3	8.85e-65	248	4223	0.101	0.049	Q8MPN3_DROME Perlecan OS=Drosophila melanogaster OX=7227 GN=trol PE=2 SV=1
17	M9NDL5	1.14e-64	248	4434	0.101	0.047	M9NDL5_DROME Terribly reduced optic lobes, isoform AF OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
18	M9NES6	1.45e-64	247	4451	0.101	0.047	M9NES6_DROME Terribly reduced optic lobes, isoform AU OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
19	E1JJC0	1.68e-64	247	4411	0.101	0.047	E1JJC0_DROME Terribly reduced optic lobes, isoform AH OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3
20	Q9W4Y3	1.91e-64	247	4479	0.101	0.046	Q9W4Y3_DROME Terribly reduced optic lobes, isoform AT OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	2.1e-05	36.0	EGF-like domain
2	PF00050 Kazal_1	1.1e-59	209.5	Kazal-type serine protease inhibitor domain
3	PF07648 Kazal_2	2.3e-78	269.5	Kazal-type serine protease inhibitor domain
4	PF00053 Laminin_EGF	4.5e-16	70.0	Laminin EGF domain
5	PF00054 Laminin_G_1	5.3e-107	364.8	Laminin G domain
6	PF02210 Laminin_G_2	8.9e-70	244.6	Laminin G domain
7	PF13385 Laminin_G_3	0.00019	33.0	Concanavalin A-like lectin/glucanases superfamily
8	PF03146 NtA	3.9e-38	141.1	Agrin NtA domain
9	PF01390 SEA	8.5e-12	56.6	SEA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363571	0.999	Muscle, skeletal receptor tyrosine-protein kinase
2	9606.ENSP00000442600	0.999	Dystroglycan
3	9606.ENSP00000367888	0.995	Low-density lipoprotein receptor-related protein 4
4	9606.ENSP00000354923	0.992	Dystrophin
5	9606.ENSP00000298854	0.990	43 kDa receptor-associated protein of the synapse
6	9606.ENSP00000356515	0.979	Utrophin
7	9606.ENSP00000349932	0.973	Receptor-type tyrosine-protein phosphatase S
8	9606.ENSP00000327336	0.963	Biglycan
9	9606.ENSP00000304290	0.955	Acetylcholine receptor subunit beta
10	9606.ENSP00000252575	0.952	Neurocan core protein
11	9606.ENSP00000331210	0.951	Brevican core protein
12	9606.ENSP00000265077	0.950	Versican core protein
13	9606.ENSP00000365745	0.949	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
14	9606.ENSP00000367446	0.947	Exostosin-1
15	9606.ENSP00000052754	0.945	Decorin
16	9606.ENSP00000261007	0.943	Acetylcholine receptor subunit alpha
17	9606.ENSP00000374145	0.943	Acetylcholine receptor subunit gamma
18	9606.ENSP00000261858	0.942	D-glucuronyl C5-epimerase
19	9606.ENSP00000362680	0.942	Proto-oncogene tyrosine-protein kinase Src
20	9606.ENSP00000261797	0.941	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	0.998	structural molecule activity
GO:0043236	0.998	laminin binding
GO:0005200	0.990	structural constituent of cytoskeleton
GO:0098772	0.524	molecular function regulator activity
GO:0030545	0.409	signaling receptor regulator activity
GO:0097367	0.401	carbohydrate derivative binding
GO:0005539	0.377	glycosaminoglycan binding
GO:0030548	0.348	acetylcholine receptor regulator activity
GO:1901681	0.332	sulfur compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0032501	0.966	multicellular organismal process
GO:0023052	0.961	signaling
GO:0048856	0.960	anatomical structure development
GO:0071840	0.955	cellular component organization or biogenesis
GO:0016043	0.952	cellular component organization
GO:0007275	0.946	multicellular organism development
GO:0043113	0.924	receptor clustering
GO:0048731	0.888	system development
GO:0007154	0.872	cell communication
GO:0050808	0.839	synapse organization
GO:0007399	0.817	nervous system development
GO:0050896	0.799	response to stimulus
GO:0048869	0.795	cellular developmental process
GO:0030154	0.778	cell differentiation
GO:0051716	0.688	cellular response to stimulus
GO:0007165	0.642	signal transduction
GO:0007267	0.487	cell-cell signaling
GO:0061024	0.453	membrane organization
GO:0048518	0.428	positive regulation of biological process
GO:0048522	0.394	positive regulation of cellular process
GO:0099536	0.385	synaptic signaling
GO:0048468	0.376	cell development
GO:0048519	0.366	negative regulation of biological process
GO:0019222	0.303	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005615	0.998	extracellular space
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0070013	0.990	intracellular organelle lumen
GO:0005604	0.988	basement membrane
GO:0005886	0.985	plasma membrane
GO:0005794	0.959	Golgi apparatus
GO:0070062	0.916	extracellular exosome
GO:0005796	0.656	Golgi lumen
GO:0030054	0.590	cell junction
GO:0000323	0.575	lytic vacuole
GO:0005764	0.570	lysosome
GO:0120025	0.545	plasma membrane bounded cell projection
GO:0043202	0.519	lysosomal lumen
GO:0005634	0.411	nucleus
GO:0045202	0.390	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]