StarFunc result for job id O00469

User Input

>input (737 residues)
MGGCTVKPQLLLLALVLHPWNPCLGADSEKPSSIPTDKLLVITVATKESDGFHRFMQSAK
YFNYTVKVLGQGEEWRGGDGINSIGGGQKVRLMKEVMEHYADQDDLVVMFTECFDVIFAG
GPEEVLKKFQKANHKVVFAADGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIV
QQWNLQDNDDDQLFYTKVYIDPLKREAINITLDHKCKIFQTLNGAVDEVVLKFENGKARA
KNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSI
GVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIV
GPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERN
YFVRDKLDPDMALCRNAREMGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDW
KEKYINRDYSKIFTENIVEQPCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRIS
GGYENVPTDDIHMKQVDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQ
RSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEG
LPVKNGTRYIAVSFIDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6fxrA	0.927	0.976	0.000	700	0.569	0.599	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
2	AFDB:A0A2R8QKS4	0.953	0.962	0.000	730	0.574	0.579	A0A2R8QKS4.pdb.gz
3	AFDB:A0JMD1	0.951	0.960	0.000	730	0.574	0.579	A0JMD1.pdb.gz
4	AFDB:A4U7F8	0.962	0.967	0.000	733	0.689	0.693	A4U7F8.pdb.gz	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
5	AFDB:A4U7F9	0.964	0.942	0.000	754	0.695	0.679	A4U7F9.pdb.gz	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
6	AFDB:O00469	1.000	1.000	0.000	737	1.000	1.000	O00469.pdb.gz	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
7	AFDB:Q5U367	0.954	0.949	0.000	741	0.590	0.587	Q5U367.pdb.gz	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
8	AFDB:Q63321	0.941	0.953	0.000	728	0.582	0.589	Q63321.pdb.gz	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
9	AFDB:Q9VTH0	0.920	0.940	9.262E-101	721	0.427	0.437	Q9VTH0.pdb.gz	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
10	AFDB:Q20679	0.929	0.938	4.106E-97	730	0.426	0.430	Q20679.pdb.gz	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
11	AFDB:Q8IYK4	0.281	0.330	1.124E-19	626	0.092	0.109	Q8IYK4.pdb.gz	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
12	PDB:2d7iA	0.236	0.313	1.536E-7	536	0.077	0.106	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
13	PDB:6h0bB	0.253	0.344	3.455E-7	521	0.072	0.102	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
14	PDB:4d0tA	0.239	0.340	4.615E-7	496	0.038	0.056	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
15	PDB:6iwqA	0.239	0.312	1.309E-6	546	0.043	0.059	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
16	PDB:4d11C	0.235	0.375	1.387E-6	436	0.045	0.076	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
17	PDB:4fixA	0.228	0.261	3.503E-6	629	0.041	0.048	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:6pxuB	0.253	0.338	4.416E-6	532	0.045	0.062	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
19	PDB:7x8kB	0.178	0.317	1.053E-5	367	0.043	0.087	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
20	PDB:7d72K	0.190	0.348	1.252E-5	360	0.041	0.083	7d72K.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KNH4	0.0	956	730	0.574	0.579	A3KNH4_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=cb479 PE=1 SV=1
2	A4U7F8	0.0	1130	733	0.696	0.700	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
3	A4U7F9	0.0	1118	754	0.696	0.680	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
4	A8WIN7	0.0	929	730	0.579	0.585	A8WIN7_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=fc95g08 PE=1 SV=1
5	O00469	0.0	1538	737	1.000	1.000	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
6	O60568	0.0	946	738	0.570	0.569	PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1
7	Q02809	0.0	946	727	0.582	0.590	PLOD1_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2
8	Q20679	0.0	638	730	0.418	0.422	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
9	Q5U367	0.0	962	741	0.574	0.571	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
10	Q63321	0.0	942	728	0.583	0.591	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
11	Q811A3	0.0	1415	737	0.901	0.901	PLOD2_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Rattus norvegicus OX=10116 GN=Plod2 PE=2 SV=1
12	Q9R0E1	0.0	954	741	0.571	0.568	PLOD3_MOUSE Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Mus musculus OX=10090 GN=Plod3 PE=1 SV=1
13	Q9R0E2	0.0	917	728	0.574	0.581	PLOD1_MOUSE Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Mus musculus OX=10090 GN=Plod1 PE=1 SV=1
14	Q9VTH0	0.0	641	721	0.426	0.436	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
15	Q8IYK4	8.14e-21	99.8	626	0.107	0.126	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
16	Q8NBJ5	2.29e-12	72.8	622	0.058	0.069	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
17	Q5T4B2	1.06e-11	70.5	595	0.083	0.103	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
18	P0DO23	3.73e-05	49.3	394	0.073	0.137	CP2_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein CP2 OS=Arabidopsis thaliana OX=3702 GN=CP2 PE=1 SV=1
19	Q6N063	5.38e-05	48.5	350	0.062	0.131	OGFD2_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OGFOD2 PE=1 SV=2
20	Q3ED68	1.17e-04	47.4	397	0.064	0.118	ICU11_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein ICU11 OS=Arabidopsis thaliana OX=3702 GN=ICU11 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03171 2OG-FeII_Oxy	0.017	27.0	2OG-Fe(II) oxygenase superfamily
2	PF13640 2OG-FeII_Oxy_3	1.6	21.0	2OG-Fe(II) oxygenase superfamily
3	PF03452 Anp1	0.036	25.1	Anp1
4	PF00535 Glycos_transf_2	26	16.1	Glycosyl transferase family 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252599	0.945	Procollagen galactosyltransferase 1
2	9606.ENSP00000354960	0.918	Procollagen galactosyltransferase 2
3	9606.ENSP00000196061	0.912	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
4	9606.ENSP00000223127	0.905	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
5	9606.ENSP00000367755	0.900	Calmodulin-lysine N-methyltransferase
6	9606.ENSP00000317232	0.892	Peptidyl-prolyl cis-trans isomerase FKBP10
7	9606.ENSP00000225964	0.867	Collagen alpha-1(I) chain
8	9606.ENSP00000297268	0.856	Collagen alpha-2(I) chain
9	9606.ENSP00000364000	0.839	Collagen alpha-2(V) chain
10	9606.ENSP00000360882	0.830	Collagen alpha-1(V) chain
11	9606.ENSP00000364979	0.812	Collagen alpha-1(IV) chain
12	9606.ENSP00000378340	0.808	Collagen alpha-6(IV) chain
13	9606.ENSP00000304408	0.795	Collagen alpha-1(III) chain
14	9606.ENSP00000263556	0.793	Prolyl 4-hydroxylase subunit alpha-1
15	9606.ENSP00000384999	0.793	Prolyl 4-hydroxylase subunit alpha-2
16	9606.ENSP00000353654	0.777	Collagen alpha-2(IV) chain
17	9606.ENSP00000323696	0.770	Cartilage-associated protein
18	9606.ENSP00000363824	0.764	Trimeric intracellular cation channel type B
19	9606.ENSP00000359114	0.760	Collagen alpha-1(XI) chain
20	9606.ENSP00000303153	0.759	Collagen alpha-1(XXII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008475	0.998	procollagen-lysine 5-dioxygenase activity
GO:0005488	0.841	binding
GO:0016740	0.830	transferase activity
GO:0005515	0.653	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.991	response to stimulus
GO:0008152	0.946	metabolic process
GO:0009628	0.778	response to abiotic stimulus
GO:0071704	0.608	organic substance metabolic process
GO:0006950	0.608	response to stress
GO:0032502	0.596	developmental process
GO:0044238	0.584	primary metabolic process
GO:0006807	0.531	nitrogen compound metabolic process
GO:0048856	0.528	anatomical structure development
GO:0070482	0.518	response to oxygen levels
GO:0043170	0.480	macromolecule metabolic process
GO:1901564	0.460	organonitrogen compound metabolic process
GO:0032501	0.428	multicellular organismal process
GO:0001666	0.417	response to hypoxia
GO:0019538	0.407	protein metabolic process
GO:0071840	0.389	cellular component organization or biogenesis
GO:0016043	0.374	cellular component organization
GO:0044237	0.364	cellular metabolic process
GO:0036211	0.329	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005615	0.998	extracellular space
GO:0016020	0.997	membrane
GO:0031982	0.974	vesicle
GO:0031090	0.950	organelle membrane
GO:0043230	0.935	extracellular organelle
GO:0031984	0.933	organelle subcompartment
GO:1903561	0.918	extracellular vesicle
GO:0070062	0.908	extracellular exosome
GO:0043233	0.882	organelle lumen
GO:0070013	0.849	intracellular organelle lumen
GO:0098827	0.767	endoplasmic reticulum subcompartment
GO:0071944	0.765	cell periphery
GO:0042175	0.757	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.745	endoplasmic reticulum membrane
GO:0032991	0.717	protein-containing complex
GO:0030312	0.548	external encapsulating structure
GO:0062023	0.367	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16569	0.998	2-oxoglutarate + L-lysyl-[collagen] + O2 = (5R)-5-hydroxy-L-lysyl-[collagen] + CO2 + succinate
EC:1.14.11.4	0.998	procollagen-lysine 5-dioxygenase.
EC:2.-.-.-	0.830	Transferases.

[back to server]