StarFunc result for job id O00476

User Input

>input (420 residues)
MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMN
ITMVAMVNSTSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQE
RSRLCSIALSGMLLGCFTAILIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVS
YPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWSICLGCFSHQWLVSTMVVYIP
TYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLLTKKFRLITVRKIATILGSLP
SSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSFLMGASRGFSS
IAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00476	1.000	1.000	7.594E-53	420	1.000	1.000	O00476.pdb.gz	NPT4_HUMAN Sodium-dependent phosphate transport protein 4 OS=Homo sapiens OX=9606 GN=SLC17A3 PE=1 SV=2
2	AFDB:E9PTR8	0.691	0.596	8.808E-32	498	0.657	0.554	E9PTR8.pdb.gz	E9PTR8_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=2
3	AFDB:A0A0G2JX26	0.787	0.707	2.330E-29	469	0.610	0.546	A0A0G2JX26.pdb.gz	A0A0G2JX26_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=1
4	AFDB:Q14916	0.848	0.765	4.118E-26	467	0.452	0.407	Q14916.pdb.gz	NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens OX=9606 GN=SLC17A1 PE=1 SV=2
5	AFDB:Q9Y2C5	0.672	0.582	6.698E-25	497	0.502	0.425	Q9Y2C5.pdb.gz	S17A4_HUMAN Probable small intestine urate exporter OS=Homo sapiens OX=9606 GN=SLC17A4 PE=1 SV=1
6	AFDB:Q62795	0.708	0.647	1.182E-22	465	0.448	0.404	Q62795.pdb.gz	NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus OX=10116 GN=Slc17a1 PE=2 SV=1
7	AFDB:B2RE38	0.834	0.711	8.580E-21	495	0.312	0.265	B2RE38.pdb.gz	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:O00624	0.587	0.565	4.879E-20	439	0.450	0.431	O00624.pdb.gz	NPT3_HUMAN Sodium-dependent phosphate transport protein 3 OS=Homo sapiens OX=9606 GN=SLC17A2 PE=2 SV=2
9	AFDB:Q5Q0U0	0.838	0.714	1.140E-19	495	0.321	0.273	Q5Q0U0.pdb.gz	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
10	AFDB:Q1L8X9	0.784	0.565	2.096E-17	590	0.290	0.207	Q1L8X9.pdb.gz	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
11	PDB:4ybqB	0.521	0.479	2.056E-4	462	0.129	0.117	4ybqB.pdb.gz
12	PDB:6s4mA	0.469	0.464	2.417E-4	426	0.119	0.117	6s4mA.pdb.gz
13	PDB:7sptA	0.512	0.465	7.198E-4	470	0.105	0.094	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:1pw4A	0.396	0.385	1.123E-3	434	0.131	0.127	1pw4A.pdb.gz
15	PDB:7n98A	0.499	0.450	1.682E-3	473	0.107	0.095	7n98A.pdb.gz
16	PDB:7bc7A	0.481	0.470	1.824E-3	432	0.102	0.100	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
17	PDB:7eebL	0.547	0.404	1.824E-3	597	0.124	0.087	7eebL.pdb.gz	Structure of a mammalian sperm cation channel complex.
18	PDB:4gbyA	0.500	0.450	2.520E-3	475	0.143	0.126	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
19	PDB:7wsmA	0.457	0.420	2.845E-3	464	0.140	0.127	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
20	PDB:7yr5A	0.438	0.472	3.084E-3	385	0.088	0.096	7yr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY28	0.0	583	420	0.652	0.652	A0A0G2JY28_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=1 SV=1
2	O00476	0.0	850	420	1.000	1.000	NPT4_HUMAN Sodium-dependent phosphate transport protein 4 OS=Homo sapiens OX=9606 GN=SLC17A3 PE=1 SV=2
3	Q6AZ69	1.26e-171	490	475	0.529	0.467	Q6AZ69_RAT Slc17a3 protein OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=1 SV=1
4	Q8CJH9	2.26e-171	491	498	0.529	0.446	Q8CJH9_RAT Na/Pi cotransporter 4 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=2 SV=1
5	E9PTR8	2.78e-171	490	498	0.529	0.446	E9PTR8_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=2
6	A0A0G2JX26	4.02e-148	431	469	0.479	0.429	A0A0G2JX26_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=1
7	Q9Y2C5	5.59e-121	362	497	0.419	0.354	S17A4_HUMAN Probable small intestine urate exporter OS=Homo sapiens OX=9606 GN=SLC17A4 PE=1 SV=1
8	Q14916	7.24e-114	343	467	0.462	0.415	NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens OX=9606 GN=SLC17A1 PE=1 SV=2
9	Q62795	1.30e-104	319	465	0.367	0.331	NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus OX=10116 GN=Slc17a1 PE=2 SV=1
10	O00624	7.83e-100	306	439	0.371	0.355	NPT3_HUMAN Sodium-dependent phosphate transport protein 3 OS=Homo sapiens OX=9606 GN=SLC17A2 PE=2 SV=2
11	Q5Q0U0	3.76e-66	221	495	0.271	0.230	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
12	Q9NRA2	2.00e-65	219	495	0.262	0.222	S17A5_HUMAN Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2
13	Q8BN82	1.12e-64	217	495	0.267	0.226	S17A5_MOUSE Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2
14	B2RE38	8.19e-63	212	495	0.257	0.218	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
15	Q1L8X9	4.37e-53	188	590	0.243	0.173	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
16	Q8NDX2	1.32e-52	187	589	0.250	0.178	VGLU3_HUMAN Vesicular glutamate transporter 3 OS=Homo sapiens OX=9606 GN=SLC17A8 PE=1 SV=1
17	Q8BFU8	1.56e-51	184	601	0.243	0.170	VGLU3_MOUSE Vesicular glutamate transporter 3 OS=Mus musculus OX=10090 GN=Slc17a8 PE=1 SV=1
18	Q7TSF2	3.74e-51	183	588	0.243	0.173	VGLU3_RAT Vesicular glutamate transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc17a8 PE=1 SV=2
19	Q9P2U8	4.88e-51	182	582	0.240	0.174	VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1
20	Q9JI12	1.02e-50	182	582	0.238	0.172	VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	5e-31	119.5	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000018223

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000000316	0.708	Peptidase M20 domain containing 1
2	9601.ENSPPYP00000016362	0.704	Leucine-rich repeat LGI family, member 2
3	9601.ENSPPYP00000002892	0.695	Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission mediated by AMPA-type glutamate receptors. Plays a role in suppressing the production of MMP1/3 through the phosphatidylinositol 3-kinase/ERK pathway (By similarity)
4	9601.ENSPPYP00000018610	0.686	Solute carrier family 22 member 7
5	9601.ENSPPYP00000003586	0.681	Solute carrier family 22 (organic anion/urate transporter), member 12
6	9601.ENSPPYP00000017409	0.673	Corticotropin releasing hormone binding protein
7	9601.ENSPPYP00000003588	0.663	Solute carrier family 22 (organic anion/urate transporter), member 11
8	9601.ENSPPYP00000004524	0.659	Uncharacterized protein
9	9601.ENSPPYP00000015670	0.649	Solute carrier family 22 (organic anion/urate transporter), member 13
10	9601.ENSPPYP00000016315	0.649	Urate transporter, which may play a role in the urate reabsorption by proximal tubules (By similarity). Does not transport glucose, fructose or galactose (By similarity).
11	9601.ENSPPYP00000002743	0.644	Solute carrier family 29 (equilibrative nucleoside transporter), member 3
12	9601.ENSPPYP00000018944	0.621	Solute carrier family 22 (organic cation/carnitine transporter), member 16
13	9601.ENSPPYP00000003625	0.613	Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of p-aminohippurate (PAH), 2,3- dimercapto-1-propanesulfonic acid (DMPS), cidofovir, adefovir, 9-(2- phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP), ochratoxin (OTA), acyclovir (ACV), 3'-azido- 3-'deoxythymidine (AZT), cimetidine (CMD), [...]
14	9601.ENSPPYP00000017106	0.603	Transporter
15	9601.ENSPPYP00000005491	0.589	Kit ligand
16	9601.ENSPPYP00000009916	0.589	Solute transporter for tetraethylammonium (TEA), 1-methyl-4- phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium)
17	9601.ENSPPYP00000001224	0.588	Transporter
18	9601.ENSPPYP00000004708	0.588	Transporter
19	9601.ENSPPYP00000005177	0.572	GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein
20	9601.ENSPPYP00000018489	0.564	Immunophilin protein with PPIase and co-chaperone activities. Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005436	0.999	sodium:phosphate symporter activity
GO:0008514	0.941	organic anion transmembrane transporter activity
GO:0005488	0.832	binding
GO:0005515	0.729	protein binding
GO:0022832	0.468	voltage-gated channel activity
GO:0008308	0.461	voltage-gated monoatomic anion channel activity
GO:0042910	0.406	xenobiotic transmembrane transporter activity
GO:0015562	0.403	efflux transmembrane transporter activity
GO:0019534	0.373	toxin transmembrane transporter activity
GO:0005342	0.325	organic acid transmembrane transporter activity
GO:0046943	0.322	carboxylic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.990	transport
GO:0009987	0.855	cellular process
GO:0015711	0.502	organic anion transport
GO:0006811	0.462	monoatomic ion transport
GO:0055085	0.427	transmembrane transport
GO:0044237	0.376	cellular metabolic process
GO:0071704	0.361	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.993	cytoplasm
GO:0043227	0.987	membrane-bounded organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0012505	0.981	endomembrane system
GO:0098590	0.859	plasma membrane region
GO:0031090	0.737	organelle membrane
GO:0045177	0.558	apical part of cell
GO:0005783	0.558	endoplasmic reticulum
GO:0016324	0.495	apical plasma membrane
GO:0031984	0.339	organelle subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)

[back to server]