StarFunc result for job id O00478

User Input

>input (584 residues)
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWS
DTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADP
FFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATEQ
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDG
SHIYTFPHASFSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGL
ANESGEPQAEVTSLLLPAHPGAEVSPSATTNQNHKLQARTEALY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00478	1.000	1.000	0.000	584	1.000	1.000	O00478.pdb.gz	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
2	AFDB:O00481	0.546	0.609	1.734E-86	513	0.748	0.852	O00481.pdb.gz	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
3	AFDB:Q13410	0.386	0.425	4.844E-59	526	0.423	0.470	Q13410.pdb.gz	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
4	AFDB:Q6UXG8	0.409	0.444	2.021E-56	535	0.354	0.387	Q6UXG8.pdb.gz	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
5	AFDB:Q62556	0.380	0.421	3.582E-56	524	0.394	0.439	Q62556.pdb.gz	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
6	AFDB:Q7KYR7	0.385	0.425	1.315E-55	527	0.394	0.436	Q7KYR7.pdb.gz	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
7	AFDB:Q8WVV5	0.375	0.417	2.585E-55	523	0.396	0.442	Q8WVV5.pdb.gz	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
8	AFDB:A4QPC6	0.366	0.414	9.489E-55	514	0.385	0.438	A4QPC6.pdb.gz	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
9	AFDB:Q6MG92	0.380	0.378	5.135E-52	588	0.346	0.344	Q6MG92.pdb.gz	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
10	AFDB:A2CG22	0.377	0.403	2.173E-50	539	0.342	0.371	A2CG22.pdb.gz	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
11	PDB:7y4sA	0.306	0.511	2.536E-16	343	0.116	0.198	7y4sA.pdb.gz
12	PDB:4b3nA	0.272	0.284	3.369E-14	557	0.101	0.106	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:1ngwH	0.170	0.423	2.161E-12	216	0.070	0.190	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:1jnhA	0.189	0.422	8.803E-12	208	0.060	0.168	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
15	PDB:1q0xL	0.198	0.406	1.335E-11	212	0.058	0.160	1q0xL.pdb.gz
16	PDB:1aqkL	0.198	0.429	5.160E-11	216	0.053	0.144	1aqkL.pdb.gz
17	PDB:4adfM	0.286	0.808	8.241E-11	191	0.068	0.209	4adfM.pdb.gz
18	PDB:7fabH	0.165	0.408	1.316E-10	209	0.072	0.201	7fabH.pdb.gz
19	PDB:3c2aL	0.160	0.390	1.386E-10	216	0.050	0.134	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
20	PDB:1hzhH	0.190	0.226	1.460E-10	457	0.062	0.079	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00478	0.0	1208	584	1.000	1.000	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
2	O00481	0.0	871	513	0.748	0.852	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
3	P78410	0.0	613	334	0.517	0.904	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
4	Q13410	1.02e-149	443	526	0.432	0.479	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
5	Q7KYR7	2.19e-137	411	527	0.382	0.423	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
6	Q8WVV5	2.25e-134	404	523	0.375	0.419	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
7	A4QPC6	5.88e-130	392	514	0.363	0.412	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
8	Q62556	5.80e-129	390	524	0.385	0.429	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
9	Q6UXG8	1.01e-113	351	535	0.342	0.374	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
10	A2CG22	1.83e-113	350	539	0.329	0.356	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
11	Q6MG92	5.79e-107	335	588	0.325	0.323	Q6MG92_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=3 SV=1
12	Q9JLN5	1.81e-95	305	566	0.330	0.341	ERMAP_MOUSE Erythroid membrane-associated protein OS=Mus musculus OX=10090 GN=Ermap PE=1 SV=2
13	Q6UXE8	1.78e-88	283	466	0.293	0.367	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2
14	Q6UX41	6.35e-86	278	500	0.288	0.336	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1
15	Q7TST0	8.42e-79	259	509	0.274	0.314	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
16	M0RD77	6.12e-67	222	313	0.214	0.399	M0RD77_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=1
17	A0A0G2K9U4	1.34e-65	219	346	0.205	0.347	A0A0G2K9U4_RAT Butyrophilin-like 8 OS=Rattus norvegicus OX=10116 GN=Btnl8 PE=4 SV=2
18	A0A1C9HIH9	7.40e-64	219	475	0.207	0.255	A0A1C9HIH9_HUMAN Erythroblast membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=3 SV=1
19	Q96PL5	7.40e-64	219	475	0.207	0.255	ERMAP_HUMAN Erythroid membrane-associated protein OS=Homo sapiens OX=9606 GN=ERMAP PE=1 SV=1
20	R4GMV1	1.50e-52	185	343	0.163	0.277	R4GMV1_HUMAN Tripartite motif containing 11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.3e+02	14.0	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	0.0056	28.0	Immunoglobulin I-set domain
3	PF00047 ig	1.4	20.5	Immunoglobulin domain
4	PF13895 Ig_2	1.1e+02	14.5	Immunoglobulin domain
5	PF13927 Ig_3	0.002	29.9	Immunoglobulin domain
6	PF13765 PRY	4.2e-16	69.6	SPRY-associated domain
7	PF00622 SPRY	5.1e-15	67.0	SPRY domain
8	PF07686 V-set	2e-09	49.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348751	0.914	Butyrophilin subfamily 3 member A2
2	9606.ENSP00000289361	0.875	Butyrophilin subfamily 3 member A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0002376	0.988	immune system process
GO:0065007	0.965	biological regulation
GO:0050789	0.954	regulation of biological process
GO:0002250	0.889	adaptive immune response
GO:0002460	0.872	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002443	0.838	leukocyte mediated immunity
GO:0002456	0.832	T cell mediated immunity
GO:0048518	0.705	positive regulation of biological process
GO:0019222	0.659	regulation of metabolic process
GO:0060255	0.646	regulation of macromolecule metabolic process
GO:0009987	0.564	cellular process
GO:0050794	0.495	regulation of cellular process
GO:0001817	0.481	regulation of cytokine production
GO:0009893	0.414	positive regulation of metabolic process
GO:0048583	0.411	regulation of response to stimulus
GO:0010604	0.401	positive regulation of macromolecule metabolic process
GO:0051716	0.379	cellular response to stimulus
GO:0001819	0.377	positive regulation of cytokine production
GO:0050776	0.352	regulation of immune response
GO:0032649	0.348	regulation of type II interferon production
GO:0002684	0.311	positive regulation of immune system process
GO:0048584	0.309	positive regulation of response to stimulus
GO:0032729	0.308	positive regulation of type II interferon production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.669	organelle
GO:0005622	0.523	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]