StarFunc result for job id O00482

User Input

>input (541 residues)
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00482	1.000	1.000	7.324E-71	541	1.000	1.000	O00482.pdb.gz	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
2	AFDB:Q90YL6	0.742	0.775	3.420E-59	517	0.813	0.851	Q90YL6.pdb.gz	Q90YL6_DANRE Nr5a2 protein OS=Danio rerio OX=7955 GN=zFF1 PE=2 SV=1
3	AFDB:F1QJG0	0.479	0.565	3.816E-42	454	0.530	0.632	F1QJG0.pdb.gz	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
4	AFDB:P33242	0.442	0.516	1.745E-41	462	0.527	0.617	P33242.pdb.gz	STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus OX=10090 GN=Nr5a1 PE=1 SV=3
5	AFDB:B3DKN2	0.488	0.492	1.067E-39	537	0.482	0.486	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
6	AFDB:F1DAM0	0.341	0.434	2.179E-29	421	0.462	0.594	F1DAM0.pdb.gz	F1DAM0_HUMAN Nuclear receptor subfamily 5 group A member 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
7	AFDB:Q05192	0.389	0.268	6.961E-23	808	0.292	0.196	Q05192.pdb.gz	FTF1B_DROME Nuclear hormone receptor FTZ-F1 beta OS=Drosophila melanogaster OX=7227 GN=Hr39 PE=1 SV=3
8	AFDB:Q19345	0.345	0.328	1.113E-21	572	0.272	0.257	Q19345.pdb.gz	NHR25_CAEEL Nuclear hormone receptor family member nhr-25 OS=Caenorhabditis elegans OX=6239 GN=nhr-25 PE=1 SV=1
9	AFDB:A0A2R8Y491	0.388	0.458	4.867E-21	454	0.268	0.319	A0A2R8Y491.pdb.gz	A0A2R8Y491_HUMAN Estrogen related receptor beta OS=Homo sapiens OX=9606 GN=ESRRB PE=1 SV=1
10	AFDB:Q5T6F7	0.430	0.933	1.423E-20	245	0.264	0.584	Q5T6F7.pdb.gz	Q5T6F7_HUMAN Nuclear receptor subfamily 5 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
11	PDB:3dzyA	0.347	0.609	4.128E-16	302	0.235	0.421	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.322	0.670	1.763E-8	246	0.104	0.228	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.325	0.706	4.032E-7	238	0.094	0.214	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.328	0.656	1.507E-5	259	0.091	0.189	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7p5cA	0.075	0.096	1.441E-1	392	0.052	0.071	7p5cA.pdb.gz
16	PDB:1qoyA	0.078	0.119	1.884E-1	303	0.059	0.106	1qoyA.pdb.gz
17	PDB:6ikoA	0.081	0.130	4.213E-1	303	0.044	0.079	6ikoA.pdb.gz
18	PDB:6lfmR	0.106	0.154	4.213E-1	307	0.067	0.117	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
19	PDB:3hajA	0.094	0.145	6.024E-1	286	0.048	0.091	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
20	PDB:4o9yA	0.068	0.020	6.300E-1	2490	0.072	0.016	4o9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1D8R8	0.0	530	461	0.530	0.623	F1D8R8_HUMAN Steroidogenic factor 1 nuclear receptor OS=Homo sapiens OX=9606 GN=NR5A1 PE=2 SV=1
2	F1QJG0	0.0	572	454	0.530	0.632	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
3	O00482	0.0	1132	541	1.000	1.000	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
4	P33242	0.0	536	462	0.529	0.619	STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus OX=10090 GN=Nr5a1 PE=1 SV=3
5	P45448	0.0	1011	560	0.898	0.868	NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus OX=10090 GN=Nr5a2 PE=1 SV=3
6	P50569	0.0	535	462	0.527	0.617	STF1_RAT Steroidogenic factor 1 OS=Rattus norvegicus OX=10116 GN=Nr5a1 PE=3 SV=1
7	Q04752	0.0	539	461	0.534	0.627	STF1_BOVIN Steroidogenic factor 1 OS=Bos taurus OX=9913 GN=NR5A1 PE=1 SV=1
8	Q13285	0.0	530	461	0.530	0.623	STF1_HUMAN Steroidogenic factor 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=2
9	Q90YL6	0.0	928	517	0.815	0.853	Q90YL6_DANRE Nr5a2 protein OS=Danio rerio OX=7955 GN=zFF1 PE=2 SV=1
10	Q9IAI9	0.0	565	454	0.527	0.628	Q9IAI9_DANRE Ff1b OS=Danio rerio OX=7955 GN=ff1b PE=2 SV=1
11	Q9QWM1	0.0	1008	560	0.898	0.868	NR5A2_RAT Nuclear receptor subfamily 5 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr5a2 PE=2 SV=1
12	B3DKN2	1.09e-172	500	537	0.481	0.484	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
13	F1QKV6	1.10e-172	499	511	0.481	0.509	F1QKV6_DANRE Nuclear receptor subfamily 5, group A, member 5 OS=Danio rerio OX=7955 GN=fd46g06 PE=3 SV=1
14	F1DAM0	1.65e-150	439	421	0.470	0.603	F1DAM0_HUMAN Nuclear receptor subfamily 5 group A member 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
15	Q5T6F7	2.13e-88	274	245	0.264	0.584	Q5T6F7_HUMAN Nuclear receptor subfamily 5 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
16	P33244	7.21e-56	204	1027	0.170	0.090	FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster OX=7227 GN=ftz-f1 PE=1 SV=2
17	Q19345	2.25e-50	184	572	0.144	0.136	NHR25_CAEEL Nuclear hormone receptor family member nhr-25 OS=Caenorhabditis elegans OX=6239 GN=nhr-25 PE=1 SV=1
18	Q64249	1.03e-44	167	495	0.242	0.265	NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 OS=Mus musculus OX=10090 GN=Nr6a1 PE=1 SV=1
19	Q15406	8.68e-44	164	480	0.226	0.254	NR6A1_HUMAN Nuclear receptor subfamily 6 group A member 1 OS=Homo sapiens OX=9606 GN=NR6A1 PE=1 SV=2
20	P70033	4.49e-43	160	435	0.224	0.278	NR6A1_XENLA Nuclear receptor subfamily 6 group A member 1 OS=Xenopus laevis OX=8355 GN=nr6a1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	4.8e-27	106.5	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1e-28	110.9	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356331

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.998	Catenin beta-1
2	9606.ENSP00000254227	0.984	Nuclear receptor subfamily 0 group B member 2
3	9606.ENSP00000264867	0.970	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000399968	0.958	Nuclear receptor coactivator 2
5	9606.ENSP00000348056	0.953	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000370421	0.943	Pancreas/duodenum homeobox protein 1
7	9606.ENSP00000361066	0.942	Nuclear receptor coactivator 3
8	9606.ENSP00000355925	0.939	Prospero homeobox protein 1
9	9606.ENSP00000249636	0.915	E3 SUMO-protein ligase PIAS1
10	9606.ENSP00000465676	0.904	E3 SUMO-protein ligase PIAS2
11	9606.ENSP00000368253	0.892	Nuclear receptor subfamily 0 group B member 1
12	9606.ENSP00000376077	0.849	Small ubiquitin-related modifier 1
13	9606.ENSP00000301645	0.846	Cholesterol 7-alpha-monooxygenase
14	9606.ENSP00000385216	0.842	Nuclear receptor coactivator 1
15	9606.ENSP00000360526	0.805	Zinc finger protein 217
16	9606.ENSP00000302630	0.802	Hepatocyte nuclear factor 6
17	9606.ENSP00000293771	0.744	Zinc finger protein 653
18	9606.ENSP00000318867	0.743	7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
19	9606.ENSP00000224073	0.718	Endothelial differentiation-related factor 1
20	9606.ENSP00000269216	0.706	Transcription factor GATA-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	1.000	DNA binding
GO:0003690	0.989	double-stranded DNA binding
GO:0000981	0.987	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.986	sequence-specific DNA binding
GO:1990837	0.959	sequence-specific double-stranded DNA binding
GO:0060089	0.921	molecular transducer activity
GO:0038023	0.908	signaling receptor activity
GO:0098531	0.884	ligand-activated transcription factor activity
GO:0004879	0.872	nuclear receptor activity
GO:0000976	0.847	transcription cis-regulatory region binding
GO:0008134	0.777	transcription factor binding
GO:0008289	0.325	lipid binding
GO:0000977	0.319	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0010468	0.982	regulation of gene expression
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.971	cellular process
GO:1903506	0.968	regulation of nucleic acid-templated transcription
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0048518	0.947	positive regulation of biological process
GO:0032502	0.933	developmental process
GO:0006357	0.901	regulation of transcription by RNA polymerase II
GO:0048522	0.881	positive regulation of cellular process
GO:0009893	0.850	positive regulation of metabolic process
GO:0048856	0.845	anatomical structure development
GO:0009891	0.771	positive regulation of biosynthetic process
GO:0032501	0.740	multicellular organismal process
GO:0010604	0.737	positive regulation of macromolecule metabolic process
GO:0031325	0.729	positive regulation of cellular metabolic process
GO:0010557	0.698	positive regulation of macromolecule biosynthetic process
GO:0031328	0.698	positive regulation of cellular biosynthetic process
GO:0051254	0.698	positive regulation of RNA metabolic process
GO:0045893	0.685	positive regulation of DNA-templated transcription
GO:0007275	0.653	multicellular organism development
GO:0050896	0.567	response to stimulus
GO:0045944	0.491	positive regulation of transcription by RNA polymerase II
GO:0008152	0.469	metabolic process
GO:0051716	0.419	cellular response to stimulus
GO:0044238	0.417	primary metabolic process
GO:0048513	0.414	animal organ development
GO:0048519	0.409	negative regulation of biological process
GO:0071704	0.408	organic substance metabolic process
GO:0048523	0.398	negative regulation of cellular process
GO:0048731	0.320	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0032991	0.764	protein-containing complex
GO:0005829	0.744	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]