StarFunc result for job id O00483

User Input

>input (81 residues)
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00483	1.000	1.000	1.225E-12	81	1.000	1.000	O00483.pdb.gz	NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1
2	AFDB:B2RZD6	0.962	0.951	9.419E-11	82	0.877	0.866	B2RZD6.pdb.gz
3	PDB:5z62N	0.611	0.623	3.965E-7	79	0.963	0.987	5z62N.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
4	AFDB:Q8IL73	0.424	0.201	1.613	180	0.136	0.061	Q8IL73.pdb.gz	Q8IL73_PLAF7 Cytochrome c oxidase subunit ApiCOX26, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1439600 PE=4 SV=1
5	AFDB:Q42338	0.445	0.411	2.220	88	0.136	0.125	Q42338.pdb.gz	Q42338_ARATH AT3G48140 protein OS=Arabidopsis thaliana OX=3702 GN=T24C20_20 PE=1 SV=1
6	AFDB:O54803	0.234	0.081	8.487	389	0.185	0.039	O54803.pdb.gz	P2RX6_MOUSE P2X purinoceptor 6 OS=Mus musculus OX=10090 GN=P2rx6 PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00483	1.22e-56	170	81	1.000	1.000	NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1
2	Q62425	5.20e-49	151	82	0.889	0.878	NDUA4_MOUSE Cytochrome c oxidase subunit NDUFA4 OS=Mus musculus OX=10090 GN=Ndufa4 PE=1 SV=2
3	F7FN80	4.56e-38	123	74	0.728	0.797	F7FN80_RAT NDUFA4, mitochondrial complex associated OS=Rattus norvegicus OX=10116 GN=Ndufa4 PE=1 SV=1
4	A0A8I6AXF3	1.33e-35	117	80	0.679	0.688	A0A8I6AXF3_RAT NDUFA4, mitochondrial complex associated OS=Rattus norvegicus OX=10116 GN=Ndufa4 PE=1 SV=1
5	Q810Q5	2.76e-08	48.1	83	0.333	0.325	NMES1_MOUSE Normal mucosa of esophagus-specific gene 1 protein OS=Mus musculus OX=10090 GN=Nmes1 PE=1 SV=1
6	Q9C002	2.12e-06	43.5	83	0.284	0.277	NMES1_HUMAN Normal mucosa of esophagus-specific gene 1 protein OS=Homo sapiens OX=9606 GN=NMES1 PE=1 SV=1
7	B9F4I8	1.4	29.3	714	0.136	0.015	LPA1_ORYSJ P-loop NTPase domain-containing protein LPA1 OS=Oryza sativa subsp. japonica OX=39947 GN=LPA1 PE=2 SV=1
8	Q9FJH9	2.4	28.5	738	0.123	0.014	LPAH1_ARATH P-loop NTPase domain-containing protein LPA1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At5g60760 PE=2 SV=1
9	Q9ZQH3	2.6	28.5	745	0.160	0.017	SC23D_ARATH Protein transport protein SEC23 D OS=Arabidopsis thaliana OX=3702 GN=SEC23D PE=2 SV=1
10	B1XLL7	4.7	27.7	534	0.222	0.034	NRTP_SYNP2 Nitrate/nitrite transporter NrtP OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) OX=32049 GN=nrtP PE=1 SV=2
11	Q95083	4.8	27.7	244	0.247	0.082	PSA5_DROME Proteasome subunit alpha type-5 OS=Drosophila melanogaster OX=7227 GN=Prosalpha5 PE=2 SV=2
12	Q9HCE9	6.9	27.3	1232	0.210	0.014	ANO8_HUMAN Anoctamin-8 OS=Homo sapiens OX=9606 GN=ANO8 PE=1 SV=3
13	G5EBV0	7.9	26.9	723	0.173	0.019	EGL9_CAEEL Hypoxia-inducible factor prolyl hydroxylase OS=Caenorhabditis elegans OX=6239 GN=egl-9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06522 B12D	8.3e-27	104.1	NADH-ubiquinone reductase complex 1 MLRQ subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339720

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
2	9606.ENSP00000418842	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
3	9606.ENSP00000425759	0.998	Cytochrome c oxidase subunit 7C, mitochondrial
4	9606.ENSP00000330737	0.997	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
5	9606.ENSP00000317780	0.995	Cytochrome c oxidase subunit 5A, mitochondrial
6	9606.ENSP00000184266	0.994	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
7	9606.ENSP00000258424	0.994	Cytochrome c oxidase subunit 5B, mitochondrial
8	9606.ENSP00000417656	0.994	Cytochrome c oxidase subunit 7B, mitochondrial
9	9606.ENSP00000246554	0.993	Cytochrome c oxidase subunit 6B1
10	9606.ENSP00000428895	0.993	Cytochrome c oxidase subunit 6C
11	9606.ENSP00000362060	0.992	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
12	9606.ENSP00000458770	0.992	Acyl carrier protein, mitochondrial
13	9606.ENSP00000359098	0.991	Cytochrome c oxidase subunit 7A2, mitochondrial
14	9606.ENSP00000229379	0.989	Cytochrome c oxidase subunit 6A1, mitochondrial
15	9606.ENSP00000237889	0.989	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
16	9606.ENSP00000354876	0.988	Cytochrome c oxidase subunit 2
17	9606.ENSP00000457513	0.988	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
18	9606.ENSP00000321260	0.987	Cytochrome c oxidase subunit 8A, mitochondrial
19	9606.ENSP00000417142	0.986	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
20	9606.ENSP00000354499	0.985	Cytochrome c oxidase subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008137	0.998	NADH dehydrogenase (ubiquinone) activity
GO:0044877	0.971	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1904062	0.977	regulation of monoatomic cation transmembrane transport
GO:0032409	0.976	regulation of transporter activity
GO:0048518	0.972	positive regulation of biological process
GO:0044093	0.971	positive regulation of molecular function
GO:0010155	0.968	regulation of proton transport
GO:0050790	0.963	regulation of catalytic activity
GO:0034764	0.957	positive regulation of transmembrane transport
GO:0051341	0.953	regulation of oxidoreductase activity
GO:0043270	0.952	positive regulation of monoatomic ion transport
GO:0032412	0.952	regulation of monoatomic ion transmembrane transporter activity
GO:0043085	0.942	positive regulation of catalytic activity
GO:0043467	0.942	regulation of generation of precursor metabolites and energy
GO:0032411	0.927	positive regulation of transporter activity
GO:0034767	0.927	positive regulation of monoatomic ion transmembrane transport
GO:0032414	0.910	positive regulation of ion transmembrane transporter activity
GO:0051353	0.870	positive regulation of oxidoreductase activity
GO:0009987	0.717	cellular process
GO:0008152	0.631	metabolic process
GO:0044237	0.573	cellular metabolic process
GO:0071840	0.340	cellular component organization or biogenesis
GO:0016043	0.310	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005751	1.000	mitochondrial respiratory chain complex IV
GO:0005747	0.999	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	0.998	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.998	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]