StarFunc result for job id O00487

User Input

>input (310 residues)
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KNN5	0.921	0.921	1.123E-56	310	0.981	0.981	A3KNN5.pdb.gz	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
2	AFDB:Q9V3H2	0.935	0.941	5.040E-55	308	0.884	0.890	Q9V3H2.pdb.gz	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
3	AFDB:O76577	0.929	0.923	3.913E-51	312	0.752	0.747	O76577.pdb.gz	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1
4	AFDB:Q9LT08	0.908	0.914	6.392E-51	308	0.777	0.782	Q9LT08.pdb.gz	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
5	AFDB:P41878	0.907	0.913	5.796E-48	308	0.661	0.666	P41878.pdb.gz	RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn11 PE=1 SV=2
6	AFDB:Q86IJ1	0.897	0.908	7.625E-47	306	0.665	0.673	Q86IJ1.pdb.gz	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
7	AFDB:P43588	0.902	0.913	5.088E-44	306	0.632	0.641	P43588.pdb.gz	RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN11 PE=1 SV=1
8	PDB:5l4kV	0.847	0.892	3.454E-43	293	0.945	1.000	5l4kV.pdb.gz
9	PDB:5gjqV	0.792	0.949	3.554E-42	257	0.826	0.996	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
10	AFDB:Q38BU2	0.863	0.876	1.227E-38	305	0.500	0.508	Q38BU2.pdb.gz	Q38BU2_TRYB2 Proteasome regulatory non-ATPase subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4510 PE=4 SV=1
11	PDB:5mpbV	0.820	0.875	4.914E-35	289	0.629	0.675	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
12	PDB:3jckG	0.542	0.653	5.225E-35	257	0.581	0.700	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
13	AFDB:Q8H936	0.538	0.468	6.415E-21	360	0.287	0.247	Q8H936.pdb.gz	CSN5_ORYSJ COP9 signalosome complex subunit 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CSN5 PE=1 SV=1
14	AFDB:O94454	0.519	0.537	1.712E-20	299	0.255	0.264	O94454.pdb.gz	CSN5_SCHPO COP9 signalosome complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn5 PE=1 SV=1
15	PDB:6r7fE	0.500	0.498	1.438E-18	311	0.284	0.283	6r7fE.pdb.gz
16	PDB:6gvwB	0.384	0.447	1.144E-11	262	0.187	0.221	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
17	PDB:6zonF	0.431	0.492	4.989E-11	269	0.165	0.190	6zonF.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
18	PDB:6j30U	0.435	0.510	7.209E-11	262	0.168	0.198	6j30U.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
19	PDB:6ybd8	0.466	0.457	1.042E-10	317	0.184	0.180	6ybd8.pdb.gz
20	PDB:6fvtU	0.434	0.442	1.108E-10	304	0.158	0.161	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZJ1	0.0	630	306	0.987	1.000	A0A0G2JZJ1_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
2	A0A8I6AHX8	0.0	577	285	0.919	1.000	A0A8I6AHX8_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
3	A3KNN5	0.0	631	310	0.981	0.981	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
4	O00487	0.0	644	310	1.000	1.000	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
5	O35593	0.0	644	310	1.000	1.000	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
6	Q17QP9	0.0	644	310	1.000	1.000	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1
7	Q4V8E2	0.0	644	310	1.000	1.000	Q4V8E2_RAT Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
8	Q9LT08	0.0	515	308	0.797	0.802	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
9	Q9V3H2	0.0	573	308	0.884	0.890	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
10	O76577	1.30e-166	467	312	0.723	0.718	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1
11	P41878	3.88e-155	437	308	0.684	0.688	RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn11 PE=1 SV=2
12	Q86IJ1	9.10e-153	431	306	0.668	0.676	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
13	P43588	2.89e-139	397	306	0.655	0.663	RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN11 PE=1 SV=1
14	Q8WRU0	4.36e-102	303	305	0.500	0.508	Q8WRU0_9TRYP Proteasome regulatory non-ATP-ase subunit 11 OS=Trypanosoma brucei OX=5691 GN=Rpn11 PE=2 SV=1
15	Q38BU2	5.08e-102	303	305	0.500	0.508	Q38BU2_TRYB2 Proteasome regulatory non-ATPase subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4510 PE=4 SV=1
16	Q9XZ58	7.82e-41	146	327	0.290	0.275	CSN5_DROME COP9 signalosome complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=CSN5 PE=1 SV=1
17	Q54PF3	1.68e-39	143	332	0.258	0.241	CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=csn5 PE=1 SV=1
18	A0A024R7W9	7.66e-36	133	334	0.255	0.237	A0A024R7W9_HUMAN COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), isoform CRA_a OS=Homo sapiens OX=9606 GN=COPS5 PE=2 SV=1
19	Q92905	7.66e-36	133	334	0.255	0.237	CSN5_HUMAN COP9 signalosome complex subunit 5 OS=Homo sapiens OX=9606 GN=COPS5 PE=1 SV=4
20	O35864	7.74e-36	133	334	0.255	0.237	CSN5_MOUSE COP9 signalosome complex subunit 5 OS=Mus musculus OX=10090 GN=Cops5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15027 DUF4525	1.5e+02	13.5	Domain of unknown function (DUF4525)
2	PF01398 JAB	4.9e-29	112.1	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
3	PF13012 MitMem_reg	3.1e-13	61.5	Maintenance of mitochondrial structure and function
4	PF14464 Prok-JAB	0.0092	27.2	Prokaryotic homologs of the JAB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008843972.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008819795.1	0.999	26S proteasome non-ATPase regulatory subunit 6
2	1026970.XP_008819971.1	0.999	Proteasome 26S subunit, ATPase 1
3	1026970.XP_008821634.1	0.999	Proteasome subunit alpha type-4
4	1026970.XP_008822797.1	0.999	Proteasome subunit beta type-7
5	1026970.XP_008826446.1	0.999	Proteasome subunit beta 4
6	1026970.XP_008826461.1	0.999	Proteasome 26S subunit, non-ATPase 4
7	1026970.XP_008827637.1	0.999	26S proteasome non-ATPase regulatory subunit 3
8	1026970.XP_008828981.1	0.999	Proteasome 26S subunit, ATPase 2
9	1026970.XP_008829509.1	0.999	26S proteasome non-ATPase regulatory subunit 2
10	1026970.XP_008830337.1	0.999	Proteasome subunit beta type-2
11	1026970.XP_008831132.1	0.999	Proteasome subunit alpha type-6
12	1026970.XP_008831920.1	0.999	26S proteasome non-ATPase regulatory subunit 7
13	1026970.XP_008834501.1	0.999	Proteasome subunit alpha type-2
14	1026970.XP_008836288.1	0.999	26S proteasome non-ATPase regulatory subunit 1
15	1026970.XP_008837735.1	0.999	Proteasome subunit alpha type-3
16	1026970.XP_008837793.1	0.999	Proteasome 26S subunit, ATPase 6
17	1026970.XP_008841416.1	0.999	Proteasome 26S subunit, non-ATPase 12
18	1026970.XP_008841625.1	0.999	Proteasome subunit beta 1
19	1026970.XP_008841832.1	0.999	Proteasome 26S subunit, ATPase 3
20	1026970.XP_008844808.1	0.999	Proteasome 26S subunit, ATPase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019783	0.986	ubiquitin-like protein peptidase activity
GO:0008237	0.983	metallopeptidase activity
GO:0101005	0.979	deubiquitinase activity
GO:0140492	0.947	metal-dependent deubiquitinase activity
GO:0044877	0.562	protein-containing complex binding
GO:0070628	0.335	proteasome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.975	response to stimulus
GO:0009987	0.881	cellular process
GO:0042221	0.811	response to chemical
GO:0008152	0.756	metabolic process
GO:0071704	0.745	organic substance metabolic process
GO:0010033	0.736	response to organic substance
GO:0044238	0.733	primary metabolic process
GO:0006807	0.716	nitrogen compound metabolic process
GO:0045471	0.691	response to ethanol
GO:0043170	0.663	macromolecule metabolic process
GO:1901564	0.561	organonitrogen compound metabolic process
GO:0019538	0.535	protein metabolic process
GO:0044237	0.512	cellular metabolic process
GO:0065007	0.476	biological regulation
GO:0050789	0.437	regulation of biological process
GO:0044260	0.345	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0000502	0.999	proteasome complex
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005634	0.955	nucleus
GO:0070013	0.730	intracellular organelle lumen
GO:0005654	0.697	nucleoplasm
GO:0022624	0.519	proteasome accessory complex
GO:0005838	0.456	proteasome regulatory particle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.987	Acting on peptide bonds (peptidases).

[back to server]