StarFunc result for job id O00488

User Input

>input (134 residues)
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGL
HRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVP
TEVSTEVPEMDTST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00488	1.000	1.000	7.906E-25	134	1.000	1.000	O00488.pdb.gz	ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2
2	AFDB:A9J4F5	0.562	0.489	2.179E-13	156	0.701	0.603	A9J4F5.pdb.gz	A9J4F5_HUMAN Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=1
3	PDB:6lss9	0.474	0.697	1.613E-7	86	0.634	0.988	6lss9.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
4	AFDB:Q9P370	0.622	0.666	3.767E-7	124	0.343	0.371	Q9P370.pdb.gz	BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bud20 PE=3 SV=1
5	AFDB:Q08004	0.613	0.502	5.154E-7	166	0.299	0.241	Q08004.pdb.gz	BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD20 PE=1 SV=1
6	PDB:6ft6I	0.586	0.598	1.813E-4	131	0.276	0.282	6ft6I.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
7	AFDB:Q66K41	0.261	0.095	1.275E-1	422	0.179	0.057	Q66K41.pdb.gz	Z385C_HUMAN Zinc finger protein 385C OS=Homo sapiens OX=9606 GN=ZNF385C PE=1 SV=4
8	AFDB:F4K209	0.242	0.040	5.744E-1	995	0.127	0.017	F4K209.pdb.gz	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
9	AFDB:A0A0S2Z4W4	0.243	0.040	8.368E-1	930	0.187	0.027	A0A0S2Z4W4.pdb.gz	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
10	AFDB:P18146	0.177	0.056	8.368E-1	543	0.261	0.064	P18146.pdb.gz	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
11	AFDB:Q5F1R6	0.248	0.078	8.368E-1	531	0.142	0.036	Q5F1R6.pdb.gz	DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2
12	AFDB:A0A2R8Y4Q0	0.248	0.085	8.910E-1	473	0.157	0.044	A0A2R8Y4Q0.pdb.gz	A0A2R8Y4Q0_HUMAN DnaJ heat shock protein family (Hsp40) member C21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=1
13	PDB:6g90T	0.240	0.073	4.135	462	0.104	0.030	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:3l9wB	0.098	0.044	7.742	357	0.082	0.031	3l9wB.pdb.gz	Mechanism of ligand-gated potassium efflux in bacterial pathogens.
15	PDB:1ka6A	0.130	0.162	9.345	107	0.052	0.065	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
16	PDB:3wxmB	0.154	0.061	9.345	357	0.052	0.020	3wxmB.pdb.gz	Structural basis for mRNA surveillance by archaeal Pelota and GTP-bound EF1 alpha complex
17	PDB:4cguA	0.111	0.125	9.345	112	0.104	0.125	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00488	1.27e-96	275	134	1.000	1.000	ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2
2	A9J4F5	5.05e-61	186	156	0.657	0.564	A9J4F5_HUMAN Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=1
3	Q9P370	6.18e-20	81.3	124	0.343	0.371	BUD20_SCHPO Zinc finger protein bud20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bud20 PE=3 SV=1
4	Q08004	1.23e-15	71.2	166	0.284	0.229	BUD20_YEAST Bud site selection protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD20 PE=1 SV=1
5	Q9VHM3	0.13	33.9	418	0.119	0.038	Q9VHM3_DROME LD30467p OS=Drosophila melanogaster OX=7227 GN=M1BP PE=1 SV=1
6	M9NES1	0.19	33.5	1373	0.082	0.008	M9NES1_DROME Zelda, isoform D OS=Drosophila melanogaster OX=7227 GN=zld PE=4 SV=1
7	X2BZL0	0.20	33.5	1367	0.082	0.008	X2BZL0_DROME Zelda, isoform F OS=Drosophila melanogaster OX=7227 GN=zld PE=4 SV=1
8	Q9VWC6	0.31	32.7	1596	0.082	0.007	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
9	Q7YU17	0.32	32.7	1596	0.082	0.007	Q7YU17_DROME LD47819p OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
10	Q8SX40	0.46	32.3	439	0.097	0.030	Q8SX40_DROME RE19693p OS=Drosophila melanogaster OX=7227 GN=Nnk PE=2 SV=1
11	Q9VHJ6	0.59	32.0	592	0.082	0.019	ICH_DROME Ichor OS=Drosophila melanogaster OX=7227 GN=ich PE=1 SV=2
12	Q02846	0.80	31.6	1103	0.134	0.016	GUC2D_HUMAN Retinal guanylyl cyclase 1 OS=Homo sapiens OX=9606 GN=GUCY2D PE=1 SV=2
13	Q9VEF0	1.1	31.2	430	0.104	0.033	Q9VEF0_DROME LD33778p OS=Drosophila melanogaster OX=7227 GN=Odj PE=1 SV=2
14	Q8N2R0	1.4	30.8	312	0.112	0.048	OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens OX=9606 GN=OSR2 PE=1 SV=2
15	Q91ZD1	1.4	30.8	312	0.112	0.048	OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus OX=10090 GN=Osr2 PE=1 SV=1
16	Q9C0A1	1.5	30.8	2572	0.082	0.004	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
17	Q9VS55	1.5	30.8	818	0.104	0.017	Q9VS55_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=2
18	Q64541	1.7	30.8	1028	0.119	0.016	AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Atp1a4 PE=1 SV=1
19	O14213	1.9	30.4	380	0.090	0.032	EPR1_SCHPO ER-phagy receptor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=epr1 PE=1 SV=1
20	E9Q6D6	2.0	30.4	583	0.082	0.019	ZN277_MOUSE Zinc finger protein 277 OS=Mus musculus OX=10090 GN=Znf277 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11273 DUF3073	20	17.3	Protein of unknown function (DUF3073)
2	PF12756 zf-C2H2_2	11	17.8	C2H2 type zinc-finger (2 copies)
3	PF12171 zf-C2H2_jaz	0.00033	32.1	Zinc-finger double-stranded RNA-binding
4	PF12874 zf-met	1.5e+02	14.2	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363384

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260443	0.996	Probable ribosome biogenesis protein RLP24
2	9606.ENSP00000363574	0.995	Eukaryotic translation initiation factor 6
3	9606.ENSP00000364320	0.993	mRNA turnover protein 4 homolog
4	9606.ENSP00000362153	0.991	Nucleolar GTP-binding protein 2
5	9606.ENSP00000483484	0.990	Ribosome biogenesis protein NSA2 homolog
6	9606.ENSP00000354040	0.988	Nucleolar GTP-binding protein 1
7	9606.ENSP00000419004	0.987	60S ribosomal export protein NMD3
8	9606.ENSP00000346725	0.983	Pescadillo homolog
9	9606.ENSP00000285814	0.974	Nucleolar protein interacting with the FHA domain of MKI67
10	9606.ENSP00000322396	0.961	Ribosome biogenesis regulatory protein homolog
11	9606.ENSP00000402338	0.934	Ribosome production factor 2 homolog
12	9606.ENSP00000346015	0.932	Ribosomal protein L27a
13	9606.ENSP00000395772	0.931	Guanine nucleotide-binding protein-like 3
14	9606.ENSP00000254940	0.929	60S ribosome subunit biogenesis protein NIP7 homolog
15	9606.ENSP00000338573	0.929	Guanine nucleotide-binding protein-like 3-like protein
16	9606.ENSP00000375730	0.928	60S ribosomal protein L13a
17	9606.ENSP00000413572	0.928	Notchless protein homolog 1
18	9606.ENSP00000309830	0.927	Ribosomal protein L38
19	9606.ENSP00000389103	0.927	60S ribosomal protein L23a
20	9606.ENSP00000259469	0.924	60S ribosomal protein L35

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043021	1.000	ribonucleoprotein complex binding
GO:0008270	1.000	zinc ion binding
GO:1990275	0.547	preribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051100	0.987	negative regulation of binding
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0043392	0.983	negative regulation of DNA binding
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0010556	0.973	regulation of macromolecule biosynthetic process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0010468	0.964	regulation of gene expression
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0031325	0.959	positive regulation of cellular metabolic process
GO:0031328	0.950	positive regulation of cellular biosynthetic process
GO:0010557	0.946	positive regulation of macromolecule biosynthetic process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0051254	0.946	positive regulation of RNA metabolic process
GO:1902680	0.939	positive regulation of RNA biosynthetic process
GO:2000677	0.900	regulation of transcription regulatory region DNA binding
GO:0045893	0.863	positive regulation of DNA-templated transcription
GO:0006357	0.839	regulation of transcription by RNA polymerase II
GO:0045944	0.831	positive regulation of transcription by RNA polymerase II
GO:0009987	0.744	cellular process
GO:0008152	0.609	metabolic process
GO:0071704	0.457	organic substance metabolic process
GO:0043170	0.396	macromolecule metabolic process
GO:0006807	0.364	nitrogen compound metabolic process
GO:0044237	0.364	cellular metabolic process
GO:0034641	0.336	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005730	0.998	nucleolus
GO:0005829	0.553	cytosol
GO:0032991	0.355	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]