StarFunc result for job id O00499

User Input

>input (593 residues)
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPP
DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILS
LFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLW
EPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGET
AASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQ
LKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAF1	0.680	0.680	4.936E-77	593	1.000	1.000	A0A024RAF1.pdb.gz
2	AFDB:A0A024RAF6	0.591	0.635	2.747E-71	550	0.927	1.000	A0A024RAF6.pdb.gz
3	AFDB:A0A024RAJ3	0.592	0.685	3.925E-66	506	0.853	1.000	A0A024RAJ3.pdb.gz
4	AFDB:A0A024RAF0	0.563	0.637	1.694E-64	518	0.874	1.000	A0A024RAF0.pdb.gz
5	AFDB:A0A024RAJ2	0.524	0.617	5.597E-60	497	0.813	0.970	A0A024RAJ2.pdb.gz
6	AFDB:A0A024RAE9	0.503	0.642	3.458E-54	454	0.740	0.967	A0A024RAE9.pdb.gz
7	AFDB:A0A2R8QMI5	0.575	0.591	4.418E-45	576	0.508	0.523	A0A2R8QMI5.pdb.gz	A0A2R8QMI5_DANRE Bridging integrator 1b OS=Danio rerio OX=7955 GN=bin1 PE=1 SV=1
8	AFDB:Q7TQF7	0.414	0.362	6.325E-41	686	0.518	0.448	Q7TQF7.pdb.gz	AMPH_MOUSE Amphiphysin OS=Mus musculus OX=10090 GN=Amph PE=1 SV=1
9	AFDB:A0A1D5P266	0.389	0.339	7.022E-41	682	0.506	0.440	A0A1D5P266.pdb.gz
10	AFDB:P49418	0.414	0.357	8.656E-41	695	0.518	0.442	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
11	PDB:1k0xA	0.098	0.482	1.307E-3	108	0.027	0.148	1k0xA.pdb.gz
12	PDB:3hajA	0.152	0.281	2.093E-3	286	0.049	0.101	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:6ikoA	0.252	0.425	2.205E-3	303	0.059	0.116	6ikoA.pdb.gz
14	PDB:2dybA	0.087	0.170	2.448E-3	298	0.029	0.057	2dybA.pdb.gz
15	PDB:3ehqA	0.089	0.276	2.864E-3	182	0.022	0.071	3ehqA.pdb.gz
16	PDB:1k9aB	0.093	0.124	1.059E-2	441	0.019	0.025	1k9aB.pdb.gz
17	PDB:1griA	0.089	0.241	1.175E-2	211	0.030	0.085	1griA.pdb.gz
18	PDB:2eyzA	0.097	0.182	1.305E-2	304	0.029	0.056	2eyzA.pdb.gz
19	PDB:3qwyA	0.092	0.305	1.608E-2	170	0.015	0.053	3qwyA.pdb.gz
20	PDB:2lqnA	0.091	0.170	3.524E-2	303	0.022	0.043	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00499	0.0	1213	593	1.000	1.000	BIN1_HUMAN Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1
2	O08539	0.0	1110	588	0.943	0.951	BIN1_MOUSE Myc box-dependent-interacting protein 1 OS=Mus musculus OX=10090 GN=Bin1 PE=1 SV=1
3	O08839	0.0	1104	588	0.939	0.947	BIN1_RAT Myc box-dependent-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Bin1 PE=1 SV=1
4	Q9BTH3	0.0	609	439	0.511	0.690	Q9BTH3_HUMAN Bridging integrator 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1
5	A0A2R8QMI5	6.16e-180	522	576	0.528	0.543	A0A2R8QMI5_DANRE Bridging integrator 1b OS=Danio rerio OX=7955 GN=bin1 PE=1 SV=1
6	O08838	7.16e-152	454	683	0.390	0.338	AMPH_RAT Amphiphysin OS=Rattus norvegicus OX=10116 GN=Amph PE=1 SV=1
7	P50478	6.90e-150	449	682	0.401	0.349	AMPH_CHICK Amphiphysin OS=Gallus gallus OX=9031 GN=AMPH PE=2 SV=1
8	Q7TQF7	3.24e-146	440	686	0.390	0.337	AMPH_MOUSE Amphiphysin OS=Mus musculus OX=10090 GN=Amph PE=1 SV=1
9	P49418	6.43e-142	429	695	0.390	0.332	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
10	Q6IT90	2.03e-133	405	618	0.378	0.362	Q6IT90_LAMFL Amphiphysin (Fragment) OS=Lampetra fluviatilis OX=7748 PE=2 SV=1
11	A0A0R4INS3	3.69e-131	401	691	0.388	0.333	A0A0R4INS3_DANRE Amphiphysin OS=Danio rerio OX=7955 GN=wu:fq25h04 PE=1 SV=2
12	Q6P960	1.50e-129	400	784	0.381	0.288	Q6P960_DANRE Amphiphysin OS=Danio rerio OX=7955 GN=wu:fq25h04 PE=1 SV=1
13	F1QRX4	3.43e-117	354	364	0.300	0.489	F1QRX4_DANRE Bridging integrator 1b OS=Danio rerio OX=7955 GN=bin1 PE=1 SV=1
14	Q9UBW5	1.86e-92	297	565	0.248	0.260	BIN2_HUMAN Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2 PE=1 SV=3
15	S4R418	2.44e-73	246	531	0.216	0.241	S4R418_HUMAN Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2 PE=1 SV=3
16	A0A0B4KEW6	2.78e-53	191	502	0.170	0.201	A0A0B4KEW6_DROME Amphiphysin, isoform B OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
17	A0A0B4KFR7	9.39e-53	186	373	0.191	0.303	A0A0B4KFR7_DROME Amphiphysin, isoform C OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
18	Q7KLE5	1.11e-52	192	602	0.170	0.168	Q7KLE5_DROME Amphiphysin OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
19	Q21004	5.51e-39	151	461	0.152	0.195	Q21004_CAEEL Amphiphysin OS=Caenorhabditis elegans OX=6239 GN=amph-1 PE=1 SV=1
20	Q9UUM7	1.40e-07	55.5	264	0.094	0.212	HOB3_SCHPO Protein hob3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hob3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	3.2e-37	140.0	BAR domain
2	PF00018 SH3_1	0.0013	29.6	SH3 domain
3	PF07653 SH3_2	0.014	26.5	Variant SH3 domain
4	PF14604 SH3_9	3.6e-07	41.3	Variant SH3 domain
5	PF09432 THP2	2.2e+02	13.3	Tho complex subunit THP2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316779

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479618	0.999	Myc proto-oncogene protein
2	9606.ENSP00000377015	0.993	Phosphatidylinositol-binding clathrin assembly protein
3	9606.ENSP00000373905	0.991	Dynamin-2
4	9606.ENSP00000362014	0.981	Dynamin-1
5	9606.ENSP00000267012	0.976	Bridging integrator 2
6	9606.ENSP00000216487	0.969	Ras and Rab interactor 3
7	9606.ENSP00000315130	0.968	Clusterin
8	9606.ENSP00000409667	0.967	Synaptojanin-1
9	9606.ENSP00000360798	0.966	Epidermal growth factor receptor substrate 15
10	9606.ENSP00000351926	0.963	AP-2 complex subunit alpha-1
11	9606.ENSP00000340820	0.957	Microtubule-associated protein tau
12	9606.ENSP00000347792	0.952	Synaptojanin-2
13	9606.ENSP00000348602	0.948	Amphiphysin
14	9606.ENSP00000406209	0.946	Epsin-1
15	9606.ENSP00000298316	0.944	ADP-ribosylation factor 6
16	9606.ENSP00000281419	0.933	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
17	9606.ENSP00000479322	0.932	CAP-Gly domain-containing linker protein 1
18	9606.ENSP00000292807	0.919	AP-2 complex subunit mu
19	9606.ENSP00000367545	0.917	Tumor protein p73
20	9606.ENSP00000378323	0.910	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.483	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065009	0.997	regulation of molecular function
GO:0050789	0.996	regulation of biological process
GO:0006897	0.996	endocytosis
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0051641	0.976	cellular localization
GO:0032879	0.972	regulation of localization
GO:0048522	0.970	positive regulation of cellular process
GO:0051128	0.958	regulation of cellular component organization
GO:0051336	0.955	regulation of hydrolase activity
GO:0051649	0.949	establishment of localization in cell
GO:0051049	0.948	regulation of transport
GO:0036465	0.931	synaptic vesicle recycling
GO:0140238	0.910	presynaptic endocytosis
GO:0051130	0.873	positive regulation of cellular component organization
GO:0071840	0.863	cellular component organization or biogenesis
GO:0016043	0.850	cellular component organization
GO:0043085	0.829	positive regulation of catalytic activity
GO:0060627	0.820	regulation of vesicle-mediated transport
GO:0048488	0.806	synaptic vesicle endocytosis
GO:0051345	0.776	positive regulation of hydrolase activity
GO:0030100	0.774	regulation of endocytosis
GO:0048519	0.690	negative regulation of biological process
GO:0043087	0.668	regulation of GTPase activity
GO:0019222	0.636	regulation of metabolic process
GO:0080090	0.616	regulation of primary metabolic process
GO:0060255	0.613	regulation of macromolecule metabolic process
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0048523	0.469	negative regulation of cellular process
GO:0032501	0.427	multicellular organismal process
GO:0051239	0.425	regulation of multicellular organismal process
GO:0032502	0.395	developmental process
GO:0048856	0.392	anatomical structure development
GO:0008152	0.332	metabolic process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0061024	0.317	membrane organization
GO:0051050	0.315	positive regulation of transport
GO:0051246	0.306	regulation of protein metabolic process
GO:0044085	0.305	cellular component biogenesis
GO:0006996	0.305	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.921	membrane
GO:0043227	0.905	membrane-bounded organelle
GO:0043229	0.905	intracellular organelle
GO:0043231	0.894	intracellular membrane-bounded organelle
GO:0071944	0.762	cell periphery
GO:0005886	0.411	plasma membrane
GO:0012505	0.385	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]