StarFunc result for job id O00507

User Input

>input (2555 residues)
MTAITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQ
HEDEEPAFPHTELANLDDMINRPRWVVPVLPKGELEVLLEAAIDLSVKGLDVKSEACQRF
FRDGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALN
PHCKFHIYNGTRPCELISSNAQLPEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHD
RFFNGSALNIQIIAALIKPFGQCYEFLSQHTLKKYFIPVIEIVPHLLENLTDEELKKEAK
NEAKNDALSMIIKSLKNLASRISGQDETIKNLEIFRLKMILRLLQISSFNGKMNALNEIN
KVISSVSYYTHRHSNPEEEEWLTAERMAEWIQQNNILSIVLQDSLHQPQYVEKLEKILRF
VIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPGQLDHLFDCFKASWTNA
SKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAQSDDVPVDIMDLALSAHIKILDYS
CSQDRDAQKIQWIDHFIEELRTNDKWVIPALKQIREICSLFGEASQNLSQTQRSPHIFYR
HDLINQLQQNHALVTLVAENLATYMNSIRLYAGDHEDYDPQTVRLGSRYSHVQEVQERLN
FLRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDF
FESNVLQLDPSLLTENGMKCFERFFKAVNCRERKLIAKRRSYMMDDLELIGLDYLWRVVI
QSSDEIANRAIDLLKEIYTNLGPRLKANQVVIHEDFIQSCFDRLKASYDTLCVFDGDKNS
INCARQEAIRMVRVLTVIKEYINECDSDYHKERMILPMSRAFRGKHLSLIVRFPNQGRQV
DELDIWSHTNDTIGSVRRCIVNRIKANVAHKKIELFVGGELIDSEDDRKLIGQLNLKDKS
LITAKLTQINFNMPSSPDSSSDSSTASPGNHRNHYNDGPNLEVESCLPGVIMSVHPRYIS
FLWQVADLGSNLNMPPLRDGARVLMKLMPPDRTAVEKLRAVCLDHAKLGEGKLSPPLDSL
FFGPSASQVLYLTEVVYALLMPAGVPLTDGSSDFQVHFLKSGGLPLVLSMLIRNNFLPNT
DMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVDGTDPITQINQVTHDQAVVLQ
SALQSIPNPSSECVLRNESILLAQEISNEASRYMPDICVIRAIQKIIWASACGALGLVFS
PNEEITKIYQMTTNGSNKLEVEDEQVCCEALEVMTLCFALLPTALDALSKEKAWQTFIID
LLLHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTAREKGKYSGDYFTL
LRHLLNYAYNGNINIPNAEVLLVSEIDWLKRIRDNVKNTGETGVEEPILEGHLGVTKELL
AFQTSEKKYHFGCEKGGANLIKELIDDFIFPASKVYLQYLRSGELPAEQAIPVCSSPVTI
NAGFELLVALAIGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFVG
LKNAGATCYMNSVIQQLYMIPSIRNSILAIEGTGSDLHDDMFGDEKQDSESNVDPRDDVF
GYPHQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASQLQYYVPRGFWKQFRLWGEPV
NLREQHDALEFFNSLVDSLDEALKALGHPAILSKVLGGSFADQKICQGCPHRYECEESFT
TLNVDIRNHQNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLK
RFDYDWERECAIKFNDYFEFPRELDMGPYTVAGVANLERDNVNSENELIEQKEQSDNETA
GGTKYRLVGVLVHSGQASGGHYYSYIIQRNGKDDQTDHWYKFDDGDVTECKMDDDEEMKN
QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYEQMDMIDEDDEMIRYISELTIARPH
QIIMSPAIERSVRKQNVKFMHNRLQYSLEYFQFVKKLLTCNGVYLNPAPGQDYLLPEAEE
ITMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCVLLRHSKNVRFWFTHNVLFNVSNR
FSEYLLECPSAEVRGAFAKLIVFIAHFSLQDGSCPSPFASPGPSSQACDNLSLSDHLLRA
TLNLLRREVSEHGHHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVSLDEGPGPPIK
YQYAELGKLYSVVSQLIRCCNVSSTMQSSINGNPPLPNPFGDLNLSQPIMPIQQNVLDIL
FVRTSYVKKIIEDCSNSEDTIKLLRFCSWENPQFSSTVLSELLWQVAYSYTYELRPYLDL
LFQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCP
VAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLER
SHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYT
GPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7yxxA	0.576	0.817	0.000	1754	0.641	0.934	7yxxA.pdb.gz
2	AFDB:F1Q6K1	0.618	0.606	0.000	2621	0.299	0.291	F1Q6K1.pdb.gz	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
3	AFDB:P70398	0.972	0.970	0.000	2559	0.909	0.908	P70398.pdb.gz	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
4	AFDB:Q9UPU5	0.638	0.624	0.000	2620	0.305	0.297	Q9UPU5.pdb.gz	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
5	AFDB:Q9FPT1	0.132	0.293	1.843E-18	1116	0.044	0.101	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
6	AFDB:Q22240	0.127	0.235	5.725E-18	1326	0.049	0.094	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
7	AFDB:E7EY58	0.125	0.280	8.158E-18	1092	0.057	0.133	E7EY58.pdb.gz
8	AFDB:Q09879	0.130	0.289	9.738E-18	1108	0.044	0.102	Q09879.pdb.gz	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
9	AFDB:Q76LT8	0.129	0.302	1.045E-17	1036	0.061	0.151	Q76LT8.pdb.gz	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
10	AFDB:Q9UTT1	0.131	0.287	3.133E-17	1129	0.045	0.102	Q9UTT1.pdb.gz	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
11	AFDB:Q57X20	0.140	0.230	8.750E-17	1419	0.062	0.111	Q57X20.pdb.gz	Q57X20_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.250 PE=4 SV=1
12	PDB:5cvnB	0.110	0.803	7.469E-14	321	0.035	0.280	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:3mhsA	0.105	0.549	1.747E-13	455	0.037	0.209	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5k16B	0.102	0.701	6.035E-13	328	0.036	0.284	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:7w3ax	0.107	0.513	1.627E-12	494	0.034	0.178	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:5gjqx	0.107	0.675	8.897E-11	355	0.031	0.223	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
17	PDB:7qo48	0.110	0.679	1.513E-10	372	0.034	0.231	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
18	PDB:8a9kD	0.095	0.766	2.863E-10	285	0.030	0.270	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
19	PDB:7ay1D	0.107	0.746	2.966E-10	341	0.031	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
20	PDB:4wa6D	0.093	0.511	3.417E-10	415	0.031	0.190	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q6K1	0.0	935	2621	0.305	0.298	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
2	O00507	0.0	5327	2555	1.000	1.000	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2
3	P55824	0.0	2242	2778	0.479	0.440	FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster OX=7227 GN=faf PE=1 SV=2
4	P70398	0.0	4806	2559	0.910	0.909	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
5	Q93008	0.0	4840	2554	0.916	0.917	USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4
6	Q9UPU5	0.0	955	2620	0.308	0.300	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
7	Q70CQ2	9.08e-70	265	3546	0.094	0.068	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2
8	Q9VC56	6.23e-55	216	3912	0.061	0.040	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
9	A0A0B4KHF3	6.56e-55	216	3921	0.061	0.040	A0A0B4KHF3_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
10	Q8IMW2	6.66e-55	216	3912	0.061	0.040	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
11	A0A0B4LIK5	6.90e-55	216	3921	0.061	0.040	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
12	A0A0B4KI06	7.02e-55	216	3930	0.061	0.040	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
13	Q24574	6.16e-34	146	1556	0.049	0.080	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
14	Q09879	2.31e-33	144	1108	0.047	0.107	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
15	Q9UTT1	4.38e-33	143	1129	0.050	0.112	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
16	Q86UV5	1.75e-32	141	1035	0.041	0.100	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
17	Q84WU2	2.54e-31	137	1115	0.044	0.101	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
18	Q8BY87	1.45e-30	135	1376	0.043	0.081	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
19	A0A0R4IB93	2.08e-30	134	1047	0.037	0.090	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
20	Q9FPT1	2.30e-30	134	1116	0.047	0.107	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10302 Dsc3_N	2.7e+02	13.5	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
2	PF12030 DUF3517	1.9e-98	341.4	Domain of unknown function (DUF3517)
3	PF00443 UCH	2.6e-48	176.5	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	1.2e-16	72.9	Ubiquitin carboxyl-terminal hydrolase
5	PF09454 Vps23_core	9.8e+02	11.1	Vps23 core domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010355054.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369065.1	0.803	Thyroid hormone receptor interactor 12
2	61622.XP_010375728.1	0.792	Belongs to the peptidase C19 family.
3	61622.XP_010385875.1	0.789	Unkempt family zinc finger
4	61622.XP_010385556.1	0.775	BCL2 family apoptosis regulator
5	61622.XP_010372596.1	0.766	Catenin beta-1
6	61622.XP_010353180.1	0.741	E3 ubiquitin-protein ligase MIB1
7	61622.XP_010386339.1	0.679	Peroxisomal biogenesis factor 5
8	61622.XP_010359465.1	0.673	Epsin-2 isoform X1
9	61622.XP_010385361.1	0.673	Epsin 1
10	61622.XP_010375088.1	0.671	SMAD family member 4
11	61622.XP_010376974.1	0.627	Peroxisomal biogenesis factor 5 like
12	61622.XP_010365812.1	0.621	Belongs to the ubiquitin-conjugating enzyme family.
13	61622.XP_010362811.1	0.619	HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
14	61622.XP_010357545.1	0.618	Ubiquitin
15	61622.XP_010384959.1	0.618	ubiquitin-60S ribosomal protein L40 isoform X1
16	61622.XP_010365816.1	0.617	NUAK family SNF1-like kinase 1
17	61622.XP_010381698.1	0.611	Doublecortin
18	61622.XP_010377339.1	0.602	Yes associated protein 1
19	61622.XP_010360689.1	0.597	Acts as a tumor suppressor in many tumor types
20	61622.XP_010350854.1	0.593	Mindbomb E3 ubiquitin protein ligase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.990	cysteine-type endopeptidase activity
GO:0019899	0.805	enzyme binding
GO:0044389	0.610	ubiquitin-like protein ligase binding
GO:0031625	0.579	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.955	cellular process
GO:0032501	0.932	multicellular organismal process
GO:0032502	0.929	developmental process
GO:0007276	0.861	gamete generation
GO:0019538	0.837	protein metabolic process
GO:0050789	0.822	regulation of biological process
GO:0036211	0.797	protein modification process
GO:0048232	0.779	male gamete generation
GO:0050794	0.748	regulation of cellular process
GO:0006508	0.587	proteolysis
GO:0003006	0.536	developmental process involved in reproduction
GO:0044237	0.523	cellular metabolic process
GO:0019222	0.492	regulation of metabolic process
GO:0050896	0.486	response to stimulus
GO:0060255	0.433	regulation of macromolecule metabolic process
GO:0007283	0.396	spermatogenesis
GO:0048518	0.374	positive regulation of biological process
GO:0048856	0.369	anatomical structure development
GO:0048519	0.367	negative regulation of biological process
GO:0070647	0.356	protein modification by small protein conjugation or removal
GO:0016043	0.351	cellular component organization
GO:0051171	0.346	regulation of nitrogen compound metabolic process
GO:0080090	0.340	regulation of primary metabolic process
GO:0048523	0.315	negative regulation of cellular process
GO:0031323	0.313	regulation of cellular metabolic process
GO:0007275	0.307	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.969	nucleus
GO:0005829	0.950	cytosol
GO:0070013	0.924	intracellular organelle lumen
GO:0031981	0.904	nuclear lumen
GO:0005654	0.652	nucleoplasm
GO:0016020	0.478	membrane
GO:0045177	0.321	apical part of cell
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.990	Cysteine endopeptidases.

[back to server]